SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019246 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000019246
Domain Number - Region: 41-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00136
Family Fibronectin type I module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019246   Gene: ENSSTOG00000019953   Transcript: ENSSTOT00000021352
Sequence length 139
Comment pep:known_by_projection scaffold:spetri2:JH393334.1:3746433:3747580:-1 gene:ENSSTOG00000019953 transcript:ENSSTOT00000021352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALRMLWAGQTKGILGGWGIICLVMSLLLQYPGVHSKCYFQAQAPCHYEGKYFTLGESWL
RKDCFHCTCLHPVGVGCCDTSQHPIDFPAECEVRQEAGTCQFSLVQKSDPRLPCKGGGPD
LEWGSANTPVPGVPAPHSG
Download sequence
Identical sequences I3N4F0
ENSSTOP00000019246 ENSSTOP00000019246 XP_005326315.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]