SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019251 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019251
Domain Number 1 Region: 81-301
Classification Level Classification E-value
Superfamily DNA-glycosylase 2.51e-68
Family Mismatch glycosylase 0.0000329
Further Details:      
 
Domain Number 2 Region: 347-485
Classification Level Classification E-value
Superfamily Nudix 9.34e-25
Family MutY C-terminal domain-like 0.00000195
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019251   Gene: ENSSTOG00000026107   Transcript: ENSSTOT00000023678
Sequence length 542
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:26484385:26488392:-1 gene:ENSSTOG00000026107 transcript:ENSSTOT00000023678 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIMRKLRAAVGSNLGKQAASQERRKKRAPNSSQAKPSAPKAYAGRISECPGTPADLASQQ
EEEIFQASVSPYHLFRNRTEIIAFRKSLLSWYDTEKRDLPWRRQAEDEEDLDRRAYAVWV
SEVMLQQTQVATVINYYTRWMQKWPTLQNLANASLEEVNQLWAGLGYYSRGRRLQEGARK
VVEELGGHMPRTADTLQQLLPGVGRYTAGAIASIAFGQATGVVDGNVVRVLCRVRAIGAD
SKSTLVSQHLWSLAQQLVDPNRPGDFNQAAMELGATVCTPQRPLCSQCPVQSLCRARQRV
EKEQFSASWNLQGTPDVEDCTPITGKCQLCLPSTEPWNYTLGVANFPRKASRRPPREEYL
AICVLEQPRALGGTHILLVQRPSSGLLAGLWEFPSVTLEHSGQHQHKDLLQKLQSWTGPL
PATHLQYLGEVSHTFSHIKLTYQVYGLALEGQTPVTTPPGARWLTREEFHTAAVSTAMKK
VFRVYEDHQPGTCKGSKRSQLSSPTSQKKPSWKKPNRGQQVLDSFFWPHIPTDTPSLNSV
AQ
Download sequence
Identical sequences ENSSTOP00000019251 ENSSTOP00000019251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]