SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019275 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019275
Domain Number 1 Region: 43-262
Classification Level Classification E-value
Superfamily PLP-binding barrel 1.44e-36
Family Alanine racemase-like, N-terminal domain 0.0000000424
Further Details:      
 
Domain Number 2 Region: 246-378
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 4.19e-22
Family Eukaryotic ODC-like 0.000029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019275   Gene: ENSSTOG00000026633   Transcript: ENSSTOT00000025933
Sequence length 379
Comment pep:known_by_projection scaffold:spetri2:JH393578.1:1042177:1043378:-1 gene:ENSSTOG00000026633 transcript:ENSSTOT00000025933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VNGFTNEEFHCHFLEEGFTVKDILNHKINESSSDDKGAFYVADLGDILKKYLRWLKALPH
ATPFHAVKCNDNRAIGKILPAIGTGFDCTRKTVRITYANPCKQSSQIKCAASIEPKEVEL
MKVARVHLKAKLLQISSDDSKAVCHLSVKFGATKTSRLLLELAKELNIDVIGVSFHVRSG
CTDPEILVQAISDAHCVFDMGAEVGFSVYMLDIGRGFPGCEDVKLKFEEISSVIIRALDK
YFLLDSGVRNIAEPGSYYIASAFTLADNLIAKIMLKEQIGSDDEYESSKYTFKYYVNDGV
FSFNCILYDYARIKPLLQKRPKPDEKYYRGLTCDSLQWIVQHCDLPEMHVGNMGSYTVAT
ASTFNRFERPTIYYVMSGP
Download sequence
Identical sequences ENSSTOP00000019275 ENSSTOP00000019275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]