SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019513 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019513
Domain Number 1 Region: 350-470
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000000033
Family Glyoxalase I (lactoylglutathione lyase) 0.033
Further Details:      
 
Domain Number 2 Region: 214-339
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 0.0000000000409
Family Glyoxalase I (lactoylglutathione lyase) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019513   Gene: ENSSTOG00000028983   Transcript: ENSSTOT00000019459
Sequence length 507
Comment pep:known_by_projection scaffold:spetri2:JH393348.1:7003309:7026342:1 gene:ENSSTOG00000028983 transcript:ENSSTOT00000019459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLTPFNLSTGNSFMYSRRLKKKTFGTAPAFRASAISLRPSSSIFPCLSRNDLDLTIVIT
LLNTSPQPPIPRKSFIVAKSCLFPGTRRRGWGHLKRLFRSLPLGMRLRASRGCFRGERFR
STTSPDGNTTFKGLRRNARTQRRADPKSGPLAATVAQKNTRSSPAAPSFPYRGSRQESAP
SITSDVTRPRRRLWVGRRCLSAGGVALGVMAGRRALHFVFKVGNRFQTTHFFRDVLGMKV
LRHEEFEEGCKAACNGPYDGKWSKTMVGFGPEDDHFVAELTYNYGIGDYKLGNDFMGITL
ASSQAVSNARKLEWPLSEVAEGVFEIEAPGGYKFYLQNRSLLQSDPVLKVTLAVSDLQKS
LHYWSNLLGMKIYEQDEEKQRALLGYADNQCKLELQGIEGPVDHAAAFGRIAFSCPHKEL
PDLEDLMKKENQTILTPLVSLDTPGKATVQVVILADPDGHEICFVGDEAFRELSKMDPEG
SKLLDDAMAADKSDEWFAQRNKPKASG
Download sequence
Identical sequences ENSSTOP00000019513 ENSSTOP00000019513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]