SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019882 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019882
Domain Number 1 Region: 220-300
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000226
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0067
Further Details:      
 
Domain Number 2 Region: 81-137
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.000000157
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.06
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000019882
Domain Number - Region: 10-49
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0048
Family HLH, helix-loop-helix DNA-binding domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019882   Gene: ENSSTOG00000023146   Transcript: ENSSTOT00000025911
Sequence length 802
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:3144796:3150240:-1 gene:ENSSTOG00000023146 transcript:ENSSTOT00000025911 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYRSTKGASKARRDQINAEIRNLKELLPLAEADKVRLSYLHIMSLACIYTRKGVFFAGGT
PLAGPTGLLSAQELEDIVAALPGFLLVFTAEGKLLYLSESVSEHLGHSMVDLVAQGDSIY
DIIDPADHLTVRQQLTLPSALDTDRLFRCHFNTSKSLRRQSAGNKLVLIRGRFHAHPPGA
YWAGNPVFTAFCAPLEPRPRPGPGPGPGPGPASLFLAMFQSRHAKDLALLDISESVLIYL
GFERSELLCKSWYGLLHPEDLAHASAQHYRLLAESGDIQAEMVVRLQAKNGGWAWIYCLL
YSEGPEGPITANNYPISDSEAWSLRQQLNSEDTQAAYVLGTPTMLPSFPENILSQEQCSN
PLFTPPLGAPRSTGFPNTPGLGVVSASEELPRPPKELDFSYLPFPSGPEPSLHAELSKDL
VCTPPYTPHQPGGCAFLFSLHEPFQTHLPAPSSSLQEQLTPSTATFSDQLTPSSATFPDP
LTSPLPGQLTETSARSYEDQLTPCTSTFPDQLLPSTATFPEPLSSPSHEQLTPPSTAFQA
PLNSPSQTFPEQLSPNPTKTYFAQEGCSFLYEKLPPSPSSPGNGDCTLLALAQLRGPLSV
DVPLVPEGLLTPEASPVKQSFFHYSEKEQNEIDRLIQQISQLAQGMDRPFSAEAGTGGLE
PLGGLEPLDSNLSLSGAGPPVLSLDLKPWKCQELDFLADPDNIFLEETPVEDIFMDLSTP
DPNGDWDSGDPEAEGPGGAPSPCNNLSPEDHSFLEDLATYETAFETGVSAFPYDGFTDEL
HQLQSQAQDSFHEDGSGGEPTF
Download sequence
Identical sequences I3N686
XP_005333442.1.77405 ENSSTOP00000019882 ENSSTOP00000019882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]