SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000019911 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000019911
Domain Number 1 Region: 30-487
Classification Level Classification E-value
Superfamily ALDH-like 7.07e-75
Family ALDH-like 0.0000117
Further Details:      
 
Domain Number 2 Region: 501-770
Classification Level Classification E-value
Superfamily ALDH-like 2.88e-45
Family ALDH-like 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000019911   Gene: ENSSTOG00000014893   Transcript: ENSSTOT00000029071
Sequence length 803
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:3326570:3338892:1 gene:ENSSTOG00000014893 transcript:ENSSTOT00000029071 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETRAELRAHEIFTTLEYGPVPESYACATAWLDTQDRCLGHYVNGKWLKPVHGDIVPWW
DPISGRRCPLVIRGSSHTNAPHLCSHLRTPTSSWGLLSSTHWGQFLPRLAKMIQKHQRLL
WTLESLATGRAIREVRDGDVPLAQQLLQFHAVQAYTQEEALAGWEPVGVVGLILPPKFSF
LEMMWRICPALAMGCTVVALVPLASPTPLLLAQLAGELGSFPGIINVISGPASLGPALAS
WPGVQKVAFCGAIEEGRALRRTLAGEGAELGLALGTESLLLLTDSADVDSAVEGVVDAAW
SDRSPGGLRLLVQESVWDETMKRLQVRMGRLRGGQEVDGAVDMGVKEPTAYILARNYVEE
ARKQGAQVFQASEMPSVSPFCPPTLITGLPPASPCAQAEVPWPLVMASAFRTAKEALAIV
NGTPRGGSASVWSERLGLALELGYGLQMGTVWINAHGLRDPAVPTGGCKESGSSWHGGLD
GLYEYLRPSGTPARVPFLCENLNYDTFGLAVPPALPAGPEMGPSPAPPYGLFVGGRFQAP
GSRSSRPIQDSSGNLHGYVAEGGAKDVRDAVEAAHQAAPGWAGQSPGARAALLWALAAAL
ERRVPTLASRLERQGVELKAAKAEVELSIQRLRTWGAQAQAQGHTLQVAGLRGPVLRLRE
PLGVLAIVCPDELPLLAFVSLLAPALAHGNTVVLVPSGTCPLLALEVCQDMATLFPAGLV
NVVTGNRDHLTRCLALHQDIQALWYFGSAQGSQFVEWASAGNLKPVWVNRGCPRAWDQEA
EGAGPELALRAARTKALWLPMGD
Download sequence
Identical sequences ENSSTOP00000019911

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]