SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020138 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020138
Domain Number 1 Region: 288-345
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000164
Family BSTI 0.064
Further Details:      
 
Domain Number 2 Region: 652-713
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000018
Family ATI-like 0.074
Further Details:      
 
Domain Number 3 Region: 752-814
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000899
Family ATI-like 0.024
Further Details:      
 
Domain Number 4 Region: 3925-3981
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000965
Family ATI-like 0.062
Further Details:      
 
Domain Number 5 Region: 5111-5168
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000018
Family BSTI 0.025
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020138
Domain Number - Region: 338-409
Classification Level Classification E-value
Superfamily FnI-like domain 0.000272
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number - Region: 5406-5495
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.000376
Family Gonadodropin/Follitropin 0.017
Further Details:      
 
Domain Number - Region: 1126-1178
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000589
Family BSTI 0.071
Further Details:      
 
Domain Number - Region: 814-854
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family Fibronectin type I module 0.062
Further Details:      
 
Domain Number - Region: 1186-1220
Classification Level Classification E-value
Superfamily FnI-like domain 0.0816
Family Fibronectin type I module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020138   Gene: ENSSTOG00000027330   Transcript: ENSSTOT00000024454
Sequence length 5503
Comment pep:known_by_projection scaffold:spetri2:JH393626.1:132468:209217:1 gene:ENSSTOG00000027330 transcript:ENSSTOT00000024454 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TGDPLLRMTDTPPLSTIPVVQAPNPAHNGRVCSTWGDSHYKTFDGDIFRFPGLCNYVFSA
HCGAAYEDFNVQLRRSRAANTTTLSRVIMKLDGLVIELNESSVLVNGHPVQLPFSQSGVL
MERSNGNLKVTARLGLVFMWDQDDDSLLLELDSKFANQTCGLCGDFNGIPVFNEFLSHDV
RLTPMEFGNLQKMDGPTEQCQDPDPAPQNCSISSGICEELLRGQLFSGCAALVDVSSYVE
ACRQDLCLCEQADLPSCICHTLAEYSRQCAHAGGLPQDWRGPDLCYQTCPLNMQHQECGS
PCTDTCSNPQRSQLCEDHCVAGCFCPEGTVFDDIGQTGCVPMSQCSCMYNGTSYAPGANY
STDCTRCTCSGGRWSCQEVPCQGTCSVLGGSHLSTFDEKQYTVHGDCSYVLTKPCHDDAF
TVLAELRRCGLTESETCLKGVELRLGGGPTAVVVKASGEVFVNQIYTQLPVSTANVTLFR
PSTFFIIAQTHLGVQLAIQLVPTMQVFVRLAPELRGLTCGLCGNFNSIQADDFRTNSGVV
EGTGAAFANTWKTQAACPNAKSSFEDPCSLSVENEKYAQHWCSQLTSPDGPFAQCHATVS
PSTYYSNCMFDTCNCEKSEDCMCAALSSYVQACAAKGVLLRGWRAGVCTKPTTTCPKSMT
YHYHISTCQPTCRALSEEDVTCHVSFVPVDGCACPEGMFLDASDKCVPAASCPCYHRGSM
VPNGESLHDSGAVCTCTQGTLTCIGGPAPTQVCDAPMVYFDCHNATHGATGAGCQKSCHT
LDMACYSPQCEPGCVCPPGLVADGSGGCIAAEDCPCMHNGASYRPGETIWAGCNTCTCEN
RMWRCTEEPCQATCALYGDGHFLTFDGQRYTFSGDCQYTLVQDHCGGNGSAKDAFRVVTE
NVPCGTTGTTCSKDIKIFLGSYELKLSSGKVEVVQKGAGQEPPYTIRQMGIYLVVDTDAG
LVLLWDRRTSIFLRLSPEFKGRVCGLCGNFDGNALNDFTTRSQAVVGDALEFGNSWKLSP
SCPDALVPKDPCTTNPYRKAWAQKQCSIIHSATFATCHAHVEPTMYYEACVGDACACDSG
GDCECFCTAVAAYAQACHEAGVCVSWRTPDVCPLFCDYYNPQGECEWHFQPCGAPCMRTC
RNPSGRCLHDLRGLEGCYPKCPPSAPIFDEDKMQCVDKCPTPTPPPPCRIHGKSYRPGAT
VPSDKNCYSCICTENGVHCAYDSGACVCTYDGRHFHPGDVIYNTTDGMGSCISAHCGANG
TVERRVFTCSPSTPRPPTTFSFSTSPHNRTTPATPPVSSSVHCGEKCLWSPWLDVSRPGQ
GVDSGDFDTLQNLRAHGFRICQVPRAVQCRAEDAPEVPLQALGQRLECSPTAGLTCHNRD
QASGLCHNYQIRVLCCSPLPCPTSSPPARHRTTNTVPMTSATVSSTPVRTSFLKSSPTPK
TTSGTPSASASPPGRSQVTSVPTTSGVSPESCTWTQWMDGSYPGPGKDSGDFDTFHNLRS
KGYKFCERPTSVECRAQFFPNTPLAELGQQVTCNSEEGLICWNRDQLPPICYNYEIRIQC
CELVDDCRNETIGTPKSIATHPKSTEGSTTTKTTVTTGSQATSTGHTTHPTPVHTSRGTS
VGTKVTQSQTTDCQPQCTWTKWFDVDFPDPGPHGGDTETYSNILSKGERICLQPEDITRL
ECRAECRNQEQQGPLGMCLNYEVRVLCCHTPDGCPTTGTPAWTTPPEPSSSVPSTSAVSS
PWSPSSAASSTLPCFCSVLDQLYPAGALEPLVSPRHPQVCAAAGATPTTSRSTAPTTRSW
TTAPTCWCSRWYPCSATSACSSTTTSVTPRTSCPAHRPSSWSTTRTTTGRCRAQSPWSSS
LTPSVWPGTCTNDKRDECRLPGGTVAPSCSAIPLLRAPEWCSAGSWGQEPRGTASSWPSG
WHLSLQPSPARLARCTCPVARPASPTATGRTAPAPCTCTLTPPTVGPTESRAPPGGPLPG
QGTAARGAGAAAHSTFLQGPPGGRSHHRALPAQLGGDTGAALWVLSPCLAMSSSPWTPSI
LTGQATPQSPSHLISSPPGVSRTSANLSSCHSECCPRADPPQTTSQNPARTREPSLHGPG
LQPGVAEAPAWPQAPRGADAGCLASLGCQQLATPWYPPEYTRPLAGPPECVTPEPLWRAH
PCDRALHQEVTPRATPGVWAGLWPGAVVSSSLCERCWCEAASSPPSGSFLVSCETQICNT
HCPLVSAGPTTALVPWADSAGSWALGTEWTRSGVLGTEWAGSLALNGQGPGALGIELLSG
LPGTKSCPVLAQDQARLSSDGCCFVCPHVGCTIGTRPSGRAAAARPHLCASPTARGTAGT
APPCTGPLSVAPSPIHGESLGAVFTDVIGSGVQALVLSRLCPQVLPGHLHGGTQVPVLPG
AADLTEEGITLTCSLGLQHHTKLSLTWDMGIGCPPTSVMGPCPPPQECAACPEPATRGQE
VTGSHVPGRQHLPTLAPTVLARLWSDSVHLLVTALLPSHPPLPATTVPTCTPSAQGPAPG
VPASVALPVILGVLSSSPLSPQSTPKPQAHLWLSGGNLMSCIPNWGGTVPAQSSQLPWRV
RMPRTWVSACAHSLVGGGWGDQPSSQEGAHATAALPAPAPDTRAKLVPPSQDPTLPISQE
EAVRRGSLLSPHPASSCTLRQPPPPMGPVTGSGASSLGVDAQPAWVPVPLSTRPLGKAAS
AAPGPLQTPQSLSQHQVPGEKGGPVCRLTLGTSVQGQDTGPRSCLLPSCCLILSKCAGRR
ACLWLCPARTPAASAPTSRPLCPACPLPRASPRPRPSTGCWWDRGEEGTPSAEVGRASGP
SATCSGWLCPKTAGPPSSSPLSPPRLTLGSMSTTGPPRAAHQTRQWEGHVTTWCSASWGS
CPTLGISKSLWETLGTTRPAAPSACLCYSSCLPVSSFTETFTPPPTTTPKARRICPTPLP
GLWRRAESQTQPTPSMQRPLEHLTHTPVASPDTHERVWKSRPCPRPAAPTWNSWETGVTC
PAPSGTPVGKASRGTNPIITYSYNAPMKMCGTRVAQPVSACAPGRTSPKARETTRPQNTG
LQRGRAWSSAPAPGTEAGTEEAGTARCPQVPPVRSSRLPVGATGSPTHRSCEVATLPWQP
HTENVTWVKAGPHSSWDESRAMCPPEALCSPLCLGSEARMMDRDSPQAGPGSTVRATGQV
PGTARGAAGQLPLPSRNSRVPSSLPLLPAPSTGEGGQGQAGHPDPTPDPSRPSLKEQWTK
GKTGPGLASSPLEPRGSLWGHWSTTSPNSSSEIHRQGRSAKPGHPRMHPVEGAAWPPGFM
GLLGPQPKSHSGQHSVRNQRPASGWSRTGHQQGAWLGSPQGSERPSFTSWAPQCPGVAIT
EGRGLGRALQVTWPSLVVYLPSSSAWPVVFPPTTIMPNTSSPRAAWSPAFLLQHSPEPGP
QRAGVQHLGRLPLQDLRRGHLPLPRPVQLRVLCPLWSCLRGLQPADAPQLGRLQFHHQPH
CPQDPGAGAGAVPQLCPCQWTAVSRALGSHHQSSGPQSLATTTTPSWNWTLSMPTRHVGC
AETSTGSQPAMNSLSTQLYPHTISPAPEPAALPTHHLPCSCLGTCRSWMVLRRLARTPCP
PWTTTAHMKLGQGGTRRSQNKKPLPISQRTPPLDVAWNGHSEQTCVRTSGHGTCSTRSVA
RPAQTPAPTPSAPSSARTTVWPAASALQARCPHAPAPTAATPTCPGPPLLPPAAPGGPPA
LTGVCGNVRTSRALAPALCREGPTFLPMTRRHTMSTETAATFCPRCGPGRASGPLSPPTL
ATFPRGHIQPSSALGIGMLLSHTQLTHMPSPNRNVPTAASLCWPSCGNAAGQTQRTVSGA
GAAGAPHGCVGTSTRTKLMTSWPSVAWWKAQVPPSPTPGRPRLPAPMPRTSSRTPAHSMT
SSSVPNMRPSCQVPHMGHLSLSPDPEWIKYVVDTCPPTCRALSEADTTCSVSFVPVDGCT
CPENTFLDDAGLCVPAQKCPCYLHGTMVANGETVQENSMVWQFSLGPAGCARPHSLPALK
AVSSPALSVGVLSYTTWAAFTVTWAAFTAAGWNQPTWGPGRLYPWAPPKCLISPGSQRAP
QGSSASGAATPWTWTVLPVPHSSAHTVSQAACVPRGWWQMGVGAALPRRTVPVSTMRHPT
SRGPPSGSTATPGMATLSPLMASATASKAAANTPWPRWVLPPLPKAVAGAHDPGPGAHDP
GPGGCPHLSPRLWLGPMTLAQVGAPTSPQGWWLGPMTLAQVGAPTSPQGTSVSLSCGHST
PVSACVSSWPSLSSTQPDIPTASPSYQHFLPSSGQTPSTRVPYTSIPCVRELPGWRGSSG
VEPHSPTGALEPGMDAGSVHWPLLWQRALWGTPRPASHLVPMQVPLVLPRGAGCPPSSAP
GQALCPASLLPVLLQGRVCGLCGNFDGNALNDFTTRSQAVSLETVGSSPRPARMPWCPRT
PVPPTLTARPGPRSSAASSTVPPSPPATLREGSLTYPVTISRTAQAATLQKASRGSPRLT
KLTSALKAAMLTMWPKVQFRVLPQDTSWVPGSAQRMGTEPASMELTFGSETARRSGNLPR
ASWLLTTAHVALSLCSRSTPPSTTRLVCMMRVPATREEIVSASALLWLPMPRPATKLACV
CPGGHQICAVSRGSAHVLKGMEVGGTVPTASTVCVRESTTLGTCQSQSAISSSSVPSTPG
PTSVLGSTVLVSTRTLPEPCFCQAFGGLFSPGEFIYNKTDRAGCNFYAICTQECGIERFH
GTCPTSSPTMSSIPVPPPSPPLGCDNAVPPRQVNESWTLENCTVARCEGNNRVILLEPSP
VASITCVNQHMPIKVWSQSQPCLFHYECECFCSGWGHWNFMTFDGTSYSFRGNCTYTLMR
EIHPRHGNLSILIDNHHCRAHDTASCPQALRVHYESTEIILTTTNTSAGEESLILFNQMR
VSRGFSRNGISVSVTGAITMGVHIPAVGVSITFNGHTFQIQLSYGYFGHNTEGQCGTCTN
SQSDDCRRPDGTIAPTCQDMAKTWVVPDSSREDCQAVPNLPVTTSPPPPVYSTTSSTPCP
ISPLCKLMLSGVFAECHSLIPPGPFFHTCVSDSCQADTLMLCQNLEAYAALCRSRDVCVD
WRNATSGLCDHPCPPTKMYRPCGPMQPAACDSRTHSPLSSRLAEGCFCPENQLLFSLSTD
ICVPECSCVGPDGSPKFLGEQWISNCQSCVCDEGSASVRCKPVQCEVQDLPLQCGQPGFM
ALTRPQANNPCCSETLCVCNVTNCPQDPPECGPGQELTYTQEQSSCCPNFSCRPKLCNYN
GTVYGVGATFPGVIPCHTCICVSMGAQAPTVQCKEVACTTSCPQGFEYSRSDRQCVPITC
FTPEGQSVQPNETWVSSHVDNCTEYRCETKSGFPVLTPRPKPCPDVSNCSGILRKAGCCY
SCEERDSCQVRGTLTILRYQGCETETVVNVSFCEGSCPGVSKYSMEAQAMQQKCTCCQER
RTHQEAVIMRCPNGTDIQHTYTQVDECSCSLSCLSFTQAPVDT
Download sequence
Identical sequences ENSSTOP00000020138 ENSSTOP00000021452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]