SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020199 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020199
Domain Number 1 Region: 72-126
Classification Level Classification E-value
Superfamily Kringle-like 1.08e-16
Family Fibronectin type II module 0.0038
Further Details:      
 
Domain Number 2 Region: 39-81
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000371
Family Fibronectin type II module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020199   Gene: ENSSTOG00000021552   Transcript: ENSSTOT00000020022
Sequence length 131
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:1537465:1541710:-1 gene:ENSSTOG00000021552 transcript:ENSSTOT00000020022 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SEAMRHLVVWVLLAVCLCGLDADLISHLNLPIKEIIMHECAIPFIYGDVVYHSCTTVRSD
FDWCSLDHDFRGRWRYCTATDPPKCTFPFTFKQRTFEQCTKEDYVLNRSWCSLTSNYNTD
RKWKQCSPLQF
Download sequence
Identical sequences ENSSTOP00000020199 ENSSTOP00000020199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]