SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020303 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020303
Domain Number 1 Region: 325-353,387-491,613-728
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.87e-55
Family Phosphate binding protein-like 0.0000000965
Further Details:      
 
Domain Number 2 Region: 37-318
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.39e-24
Family L-arabinose binding protein-like 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020303   Gene: ENSSTOG00000027498   Transcript: ENSSTOT00000027329
Sequence length 843
Comment pep:known_by_projection scaffold:spetri2:JH393474.1:2516246:2545096:1 gene:ENSSTOG00000027498 transcript:ENSSTOT00000027329 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RSLVLQLCDLLSGLRVHGVVFEDDSRAPAVAPILDFLSAQTSLPIVAVHGGAALVLTPKE
KGSTFLQLGSSTEQQLQVIFEVLEEYDWTSFVAVTTRAPGHRAFLSYIEVLTDGSLVGWE
HRGALTLDPGAGEAVLGAQLRSVSAQIRLLFCAREEAEPVFRAAEEAGLTGPGYVWFMVG
PQLAGGGGSGAPGEPLLLPGGAPLPAGLFAVRSAGWRDDLARRVAAGVAVVARGAQALLR
DYGFLPELGHDCRAQNRTHRGESLHRYFMNITWDNRDYSFNEDGFLVNPSLVVISLTRDR
TWEVVGSWEQQTLRLKYPLWSRYGRFLQPVDDTQHLTVATLEERPFVIVEPADPISGTCI
RDSVPCRSQLNRTHSPPPDAPRPEKRCCKGFCIDILKRLAHTIGFSYDLYLVTNGKHGKK
IDGVWNGMIGEVFYQRADMAIGSLTINEERSEIVDFSVPFVETGISVMVARSNGTVSPSA
FLEPYSPAVWVMMFVMCLTVVAVTVFIFEYLSPVGYNRSLATGKRPGGSTFTIGKSIWLL
WALVFNNSVPVENPRGTTSKIMVLVWAFFAVIFLASYTANLAAFMIQEEYVDTVSGLSDR
KFQRPQEQYPPLKFGTVPNGSTEKNIRSNYPDMHSYMVRYNQPRVEEALTQLKAGKLDAF
IYDAAVLNYMARKDEGCKLVTIGSGKVFATTGYGIALHKGSRWKRPIDLALLQFLGDDEI
EMLERLWLSGICHNDKIEVMSSKLDIDNMAGVFYMLLVAMGLSLLVFAWEHLVYWRLRHC
LGPTHRMDFLLAFSRGMYSCCSAEAAPPPAKPPPPPQPLPSPAYPTARQAPGPAPFVPRE
RAA
Download sequence
Identical sequences ENSSTOP00000020303 ENSSTOP00000020303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]