SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020387 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020387
Domain Number 1 Region: 1932-2091
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.74e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 2393-2450
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000122
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 2823-2880
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000942
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 2556-2607
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000262
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 5 Region: 3855-3912
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000562
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 6 Region: 3097-3146
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000719
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 7 Region: 4104-4159
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000106
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 8 Region: 3660-3718
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 9 Region: 2667-2723
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000034
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 10 Region: 3489-3532
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 11 Region: 3796-3855
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000628
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 1445-1483
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 3314-3363
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 14 Region: 1578-1628
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 15 Region: 1294-1335
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000301
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 2340-2393
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000445
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 17 Region: 1153-1216
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000484
Family ATI-like 0.062
Further Details:      
 
Domain Number 18 Region: 4467-4520
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000759
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 19 Region: 343-405
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000102
Family BSTI 0.05
Further Details:      
 
Domain Number 20 Region: 2929-2986
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000107
Family ATI-like 0.046
Further Details:      
 
Domain Number 21 Region: 4623-4673
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000116
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 22 Region: 3028-3088
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 23 Region: 1694-1754
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000144
Family BSTI 0.067
Further Details:      
 
Domain Number 24 Region: 1258-1294
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000157
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 25 Region: 2302-2339
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 26 Region: 1633-1686
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000183
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 27 Region: 4675-4732
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000183
Family BSTI 0.033
Further Details:      
 
Domain Number 28 Region: 1334-1377
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 2786-2842
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000272
Family VWC domain 0.047
Further Details:      
 
Domain Number 30 Region: 4835-4902
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000045
Family VWC domain 0.079
Further Details:      
 
Domain Number 31 Region: 700-760
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000458
Family ATI-like 0.054
Further Details:      
 
Domain Number 32 Region: 3248-3304
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000615
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 33 Region: 1374-1412
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000103
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 34 Region: 4780-4845
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000144
Family ATI-like 0.015
Further Details:      
 
Domain Number 35 Region: 2244-2283
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000183
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 36 Region: 4010-4065
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000353
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 37 Region: 3160-3211
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000067
Family BSTI 0.023
Further Details:      
 
Domain Number 38 Region: 2093-2130
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000122
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 39 Region: 2473-2518
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000139
Family ATI-like 0.02
Further Details:      
 
Domain Number 40 Region: 4277-4335
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000432
Family ATI-like 0.012
Further Details:      
 
Domain Number 41 Region: 3733-3781
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000602
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 42 Region: 801-855
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000608
Family ATI-like 0.049
Further Details:      
 
Domain Number 43 Region: 4167-4217
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000628
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 44 Region: 1774-1832
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000837
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 45 Region: 3912-3971
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000085
Family BSTI 0.027
Further Details:      
 
Domain Number 46 Region: 1486-1521
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000942
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 47 Region: 2615-2663
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000968
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 48 Region: 4534-4583
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000013
Family ATI-like 0.085
Further Details:      
 
Domain Number 49 Region: 2885-2924
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000235
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 50 Region: 768-796
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000241
Family PMP inhibitors 0.0021
Further Details:      
 
Domain Number 51 Region: 853-894
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000345
Family VWC domain 0.071
Further Details:      
 
Domain Number 52 Region: 2723-2788
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000703
Family ATI-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020387
Domain Number - Region: 3371-3428
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000311
Family ATI-like 0.043
Further Details:      
 
Domain Number - Region: 3539-3596
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000343
Family BSTI 0.045
Further Details:      
 
Domain Number - Region: 4910-5001
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00144
Family Gonadodropin/Follitropin 0.01
Further Details:      
 
Domain Number - Region: 1830-1892
Classification Level Classification E-value
Superfamily FnI-like domain 0.0022
Family VWC domain 0.071
Further Details:      
 
Domain Number - Region: 1538-1564
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00367
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 403-443
Classification Level Classification E-value
Superfamily FnI-like domain 0.0105
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number - Region: 4216-4273
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0144
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 3982-4010
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0191
Family PMP inhibitors 0.0029
Further Details:      
 
Domain Number - Region: 4751-4805
Classification Level Classification E-value
Superfamily FnI-like domain 0.0523
Family VWC domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020387   Gene: ENSSTOG00000023004   Transcript: ENSSTOT00000028591
Sequence length 5006
Comment pep:novel scaffold:spetri2:JH393337.1:5824319:5874879:1 gene:ENSSTOG00000023004 transcript:ENSSTOT00000028591 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLAVLFGMLWALANGRWCEQTETIHVEEEVAPRKEDLVPCASLYHYTRLGWRLDLPRS
GHEGLSGPPAPGLCRIYKPPETRPATWNRTVRACCPGWGGAQCTDALMEDSPGGHCFATW
QCQPLGGSANTSTENLEFPAASLGSWSPAVVAPFPFPGLSLQWQGDWLVLSGGLGVVVRL
DRSSSVSISVDHEHSGQTQGLCGLYNGRPEDDFSEPGGGLAMLAATFGNSWKLPSSEPGC
LDAVEVDQGCEGPLKGTEAGMDAGQLRAEAQDVCHQLLESPFWQCHAQVSPDEYHEACLF
AYCAGAALGRQEGRQEAVCATFANYAQACARRRIHVLWRKPGFCERLCPGGQLYSDCVSS
CPPSCSAVGQEEEGSCREECVSGCECPPGLFWDGALCVPASRCPCYHRRQRYAPGDTVHQ
LCNPCVCQDGHWHCAQALCPAECAVGGDGHYLTFDGRSFFFRGHSGCHYSLVQTDTNRQA
HSTLRHAHMDLASAAPSIYLPPPPHHQAPFPGAVLVDGQDVGLPWIGTAGLSISRASSTF
LLLRWPGVHVLWGVADPAAYITLAPHHAHQVQGLCGTFTWNQQDDFLTPAGDVETSTADF
ASRFQVAGNGKCSSGDSVLLFPCSTHSQHLAFAEATCAILHGPAFQDCHRLVDREPFQLR
CLAAVCGCAPGRDCLCAVLSAYAHRCAQEGALLSWRNQTLCPVLCPGGQEYQECAPVCGH
HCGEPEDCKELTGCVAGCNCPPGLLWDPEGQCVPPSLCSCQLGAHRYSPGSVTMKDCNRC
ICQERGLWNCTAHHCALQRAFCPGELVHAPGACLLTCDSPSANHSCPMGSTDGCVCPPGT
VLLDERCVPPDLCPCRHSGQWYPPNATIQDNCNTCVCQGRQWHCTGQLCSGWCQASGAPH
YVTFDGLTLTFPGACEYLLVREASGRFSVSAQNLPCGASGLTCTKTLAVRLEGTTVHMLR
GRAVTVNGVSVTPPKAYTGPGISLHRAGLFLLLTTRLGLTLLWDGVMPPGTRVLIQLSPH
FRGRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSALCPEPGDPPHPCTVNTHR
AAWARARCGVMLQQLFVPCHTEVPPQQHYEWCVYDTCGCDSGGDCECLCSAIAAYADECA
RHGHHVRWRSQELCPLQCEGGQVYEACGPTCPPACPTHHAEPAWHCRAIACVEGCFCPEG
TLLHGGICMEPSACPCEWGGSFFPPGTVLQKDCGNCTCQESQWHCGGDSAPCEELVPDCA
EGESPCQGSGHCIPHEWLCDNQDDCGDGSDEEGCATPGCVEGQMSCRSGHCLPLSLLCDG
QDDCGDGTDEQGCPCPHDSLACADGRCLPLTLLCDGHPDCPDAADEESCLAGQVNCIPGE
VSCMDGTCVGTIQLCDGVWDCPDGADEGPGYCPLPSLPVPPASTMPGPSTGSLEGASSPL
GSASPARSCGPLEFPCGSGECTPRGWRCDQEEDCADGSDELGCGGPCALHHAPCARGSHC
VSPGELCDGVPQCPDGSDEGPDACEGLPPPGSLNRTEFPCPEYSCPNGDCLGFHLVCDGQ
PNCELVGEAGLSPEEQGCGTWGPWSPWGPCSQTCGLGVQSQSRSCSPSGLLVLQHCPGPA
NQSQACFTKACPVDGEWSSWSSWSLCSEPCGGTRTRQRQCHPPQNGGQACALLPGGPHST
HQTEPCPQDGCPNATCSGELVFQPCAPCPLTCDDISGQAICSPRRPCSSPGCWCPEGQVL
GSEGQCVWPRQCPCLVDGARYWPGQHIKANCQLCVLNCGWSSWSPWAECLGPCGSQSIQW
SFRSPNNPRLSGRGRQCRGIHRKARRCQTQPCEGCEQQGHTHQVGERWRGGPCKVCQCLH
MGTVHCSPYCPLGSCPQGWILVEGVGESCCHCALPAENQTVPPTATPAPAPAPSPQTGPP
LVTYVLPPLGDACYSPLGLALPPGSLWTWSRQLEPPTWAALLGAPTKGPGPRAGAYAEWH
SGPPFLQLDLLQPRNLTGVIVWGPTSSSPPGSSFSLQFGTDGLHWQDYRDILPGTLSPPK
SFPRNWEDVASKVWAFSRMVQARYIRVWPHSVPHSDRQPGFFLWVELLGCEPVPPCPGAG
HRCANGDCALRGVPCDGAADCEHGSDEEGCGPLPVDTGHSTARTPTFSTQPGPLPPQPSE
EGELGSPHSFSPLPTEKRPVSPAPASKAPHPSSGESVQTGSNTPTFHAGFQSLTPGMAAT
TVLPTHPMIPMTPAGQRVAPSPFPPVRCSPGQLPCKVLGCVEPEQLCDGKEDCLDGDDER
HCASPMPFMVPTTVLPGLPASRTLCSQSQLSCGSGECLPTERRCDLRPDCQDGSDEDGCV
DCVLAPWSGWSGCSRSCGLGLTFQRRELLRPPLPGGSCPLDQLRRQPCFVQACPVAGAWA
EWETWGPCSVSCGGGHQSRQRSCMDPPPKNGGAPCPGASWERAPCGLQPCTGDTDCGLGR
VHVNAELCQKGLVPPCPPSCLDPETNGSCTGPCVEGCRCPPGLLLHDSRCLPLSECPCLV
GEELKPPGMSFLLDNCSQCICERGTLVCEPGACPQPCGWSAWSSWTPCDRSCGSGVRARF
RSPSNPPAAFGGAPCEGDKQELQVCHVDCGTEVLGWTPWTSWSSCSQSCLVPGGVPGWRH
RSRLCPGLRDTSCPGEATQEEPCSPPVCPVPSSWGAWASWSACSAPCNGGIQIRGRSCSG
SAPGNPACRGPHSQTRDCNTQPCTAQCPEDMVFRSAEQCHQDGGPCPQLCLAQDSGVECT
GFCTPSCTCPPGLFLHNASCLPRSQCPCQLHGKLYAPGAVARLDSCNNCTCISGEMACTS
ELCPVACGWSPWTPWSPCSRSCDVGIRRRFRAGTSPPAAFGGAECQGPNIEAEFCSLRPC
QSPGGEWGPWASCSVPCGGGYRNRTRGSGPRVLMVFSTCNLQPCAGPVPGMCPRGQLWLD
CAQGPASCAELSAPRETKQTCHPGCYCPHGMHLLNNVCVPAQACPCAHEGRLHPPGSAVL
RPCENCSCISGLITNCTSWPCEEAQGQPTWSPWTPWSVCSASCGPARRHRHRFCDRPSSV
APSTLALGPSPATPTPLCPGPEAEEEPCLLPGCDRAGGWGPWGPWSSCSRSCGGGLRSRT
RACDQPPPQGLGDFCEGPQAQGEACQAQPCPVTDCTAIEGAQYSPCGPPCPRSCDDLVHC
VWHCQPGCYCPPGQVLSADGTLCVHPGHCGCLDLLTGERHRPGAQLARPDGCNHCTCLEG
RLNCSELPCPVPGGWCPWSEWTACFQPCRGQTRTRSRACACPAPQHGGALCPGEMGAQHQ
RETCPSSTTCPGTVDGAWSPWGPWSPCDACLGQSHRSRECSQPPTSEGGRPCPGVHWQSR
PCHDNSTQCADCGGGQSLLPCGQPCPRSCLDLSPGSVCQPGPGGCQPSCGCPPGQLSQDG
LCVLPVHCRCQYQPGAMGIPENQSRSAGSGLSSWESLEPGEVVTGPCNNCTCVAGILQCW
EVPSCPGAGVWGPWGPWEDCSVSCGGGEQLRSRHCARPPCPGLARQSRTCHTQVCREAGC
PAGRLYRECLPNGGCPFSCAHVAGRVACFSDGCEEGCHCPEGTFQHGLACVQECPCMLTA
LLLRELGASSTDAGVHAASLGEEGQPLRPGDELSPGQMFRMGCSNCSCAHGKLSCSIEDC
PEAPSFSPWDPWGPCSRSCGGLGTRTRSRQCVHPALATGGQGCQGPRQDLEYCLSPDCSG
AEGSTAEPVTGLPGGWGPWAPWSPCSRSCTDPTHPAWRSRTRLCLTNCTVGRPSQERPCN
LPSCTELQPLCSSPGCGPGNCSWTSWGPWEPCSRSCGVGQQHRLRAYRPPGPGGHWCPDI
LTAFQERRFCSLRACPVPGGWSRWSPWSWCDRSCGGGQSLRSRSCSSPPPKNGGAPCVGE
KHHARLCNPMPCEEGCPAGMELVSCANRCPRRCSDLQEGVLCQDGQACQWGCRCAEGSLE
QDSSCVPVGHCECTDAQGHSWAPGSQHQDACNNCSCQAGQLSCTAQPCPPPAHCAWSRWS
AWSPCSHSCGPRGLQSRFRSSTSGSWAPECQEEQSQSQPCPQPPCPPLCLHEGRVHTLGD
SWLQGGCQQCSCTPEGIICEDTKCPGSWTLWSLWSDCPVSCGGGNQVRTRACVVPDPHHR
EPLCQGPDTQTQPCGQQPCQPLLEACSWGPWGPCSRSCGSGLASRSGSCPCLPAEAEPTC
NGTFPHLDTQACYAGPCLEECLWSGWSSWTRCSCQVLVQQRYRHQGPAPGGTAEGPPCTR
LDGHFRPCPTGNCSEDSCTPPFEFQACGSPCAGLCATHLSRQLCQDLPACQPGCYCPKGL
LEQAGACIPPEQCNCWHISEEGAEVTLAPGDHLQLGCKECECWHGELRCTSGGCAGLLPL
SSWSEWSPCGPCLPRSALTRTSRTTLEEHWPPNTTGLWPPSTSLLVSEQHRHRLCLDPET
GRPWAGDPQLCTAPLNQQRLCPDPEACQDSCQWNPWGPWSPCQVPCSGGFRMRWREAGGL
PGGACRGPWAQTQSCNMGPCPGKSCEAKDTVPTLECANQCPRSCMDLWDRVQCLQGPCSP
GCRCPPGQLVQDGHCVPISSCRCGLPSANASWELAPAQVVQLDCHNCTCINGSLVCPHLE
CPTLGPWSAWSKCSVACGGGTMDRHRSCKEHPQGALCQAQDMKQQQDCNLQPCPECPSGQ
VFSACAASCPSLCSHLQPGTICTQEPCQPGCGCPRGQLLHNGTCVPPAACPCTQLLLPWG
LTLTLEEQAQELPPGAVLTRNCTRCTCQDGAFSCSPIDCQECPPGEMWQHVGPEELGPCE
WTCQETNTTAAQGNCSAVQTPGCICQEGYFRSQAGPCVPADQCECWHHGHLHLLGSEWQE
DCESCQCLRGRSVCTRHCPLLNCAQDEVTVQEPGSCCPTCRRETLEAQSASCRHLTELRN
LTKGPCHLDQVEVSYCSGHCPSSTNVMPEEPYLQSQCDCCSYRLDPDSPVRILNLQCPDG
RTEPVVLPVINSCQCSACQAGDFSKR
Download sequence
Identical sequences ENSSTOP00000020387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]