SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020415 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020415
Domain Number 1 Region: 416-899
Classification Level Classification E-value
Superfamily ALDH-like 1.26e-151
Family ALDH-like 0.00000000294
Further Details:      
 
Domain Number 2 Region: 1-200
Classification Level Classification E-value
Superfamily Formyltransferase 3.53e-52
Family Formyltransferase 0.00000000353
Further Details:      
 
Domain Number 3 Region: 205-243
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 0.00000000000283
Family Post formyltransferase domain 0.00025
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020415
Domain Number - Region: 334-400
Classification Level Classification E-value
Superfamily ACP-like 0.000142
Family Acyl-carrier protein (ACP) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020415   Gene: ENSSTOG00000026302   Transcript: ENSSTOT00000022845
Sequence length 900
Comment pep:known_by_projection scaffold:spetri2:JH393708.1:456521:484282:-1 gene:ENSSTOG00000026302 transcript:ENSSTOT00000022845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIAVIGQSLFGQEVYSHLRKEGHEVVGVFTIPDKDGKADPLGLQAEKDGVPVFKFPRWR
SRGQALPDVVAKYQALGAELNVLPFCSQFIPMEVISAPRHGSIIYHPSLLPRHRGASAIN
WTLIHGDKKGGFTIFWADDGLDTGDLLLQKECEVLPDDTVSTLYNRFLFPEGIKGMVQAV
RLIAEGRAPRLPQPEEGASYEGIQKKETARINWDQPAEAIHNWIRGNDKVPGAWTEAGGQ
VCLRGTGTCLDAPWCAPWWTAKPAPCIDQPNAWSTAPTLTTPPGLRALTTSMLCICAGYK
ILASNPWATSGPSSDFTMALDRXLHKCLSAWKRILPSLSEVDDSTDFFKSGAASVDVVRL
VEEVRELCDGLELENEDVYMATAFGDFIQLLVRKLRGEDDEGDSDIDYVEKSVNKLELRM
PHQLFIGGTFVDAEGGQTYDTINPTDGSVICQVSLAQVSDVDKAVAAAKDAFENGRWGKI
SARDRGRLLYRLADLMEQHQEELATIEALDAGAVYTLALKTHVGMSIQTFRYFAGWCDKI
QGSTIPINQARPNRNLTLTKKEPVGVCGIIIPWNYPLMMLSWKTAACLAAGNTVVIKPAQ
VTPLTALKFAELTLKAGIPKGVINILPGSGSLVGQRLADHPDVRKIGFTGSTEVGKHIMK
SCALSNVKKVSLELGGKSPLIVFADCDLSKAVQMGMSSVFFNKGENCIAAGRLFVEDSIH
DQFVRRVVEEVGKMKIGNPLDRDTDHGPQNHQAHLNKLREYCQRGVREGATLACGGNQVP
RPAPVAWTAVPVTTPGSSFLFYSASCRPALTLAHFWDIDAVLSRANATEFGLASGVFTRD
INKALYVSDKLAAGTVFVNTYNKTDVAAPFGGFKQSGFGKDLGEAALNEYLRVKTVTFEY
Download sequence
Identical sequences ENSSTOP00000020415 ENSSTOP00000020415

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]