SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020481 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020481
Domain Number 1 Region: 6-416
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 2.47e-168
Family Phosphoglycerate kinase 0.00000000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020481   Gene: ENSSTOG00000020487   Transcript: ENSSTOT00000023371
Sequence length 417
Comment pep:novel scaffold:spetri2:JH393286.1:10907440:10908693:1 gene:ENSSTOG00000020487 transcript:ENSSTOT00000023371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLSKKLTLDKLDVKGKRVIMRVDFNVPMKKNQITNNQRIKAAMPSITFCLDNGAQSVVL
MSHLGRPDGVPMPEKYSLEPVAGELKALLGRDVTFLKDCVGPEVEKACASPEAGSVILLE
NLRFHLEEEGKGQDASGNKVKAEPEKVEAFRQSLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAAGFLMKKELEYFAKALENPERPFLAILGGAKVADKIQLIKNMLDKVNQMIIGGGM
AFTFLKVLHNMEIGASLFDEEGAKIVKEIMAKAEKNGVKITFPVDFITADKFDEHANTGN
ATIESGIPDGWMGLDCGPESIKKNAQVVSQAKLIVWNGPLGVFEWEAFAKGTKALMDEIV
KATSQGSVTIIGGGDTATCCAKWNTEDKVSHVSTGGGASLELLEGKSLPGVEALSNV
Download sequence
Identical sequences ENSSTOP00000017682 ENSSTOP00000020481 ENSSTOP00000017682 ENSSTOP00000020481 XP_005318639.1.77405 XP_005318642.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]