SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020677 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020677
Domain Number 1 Region: 340-471
Classification Level Classification E-value
Superfamily C-type lectin-like 9.45e-42
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 199-332
Classification Level Classification E-value
Superfamily C-type lectin-like 2.32e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 482-617
Classification Level Classification E-value
Superfamily C-type lectin-like 2.58e-34
Family C-type lectin domain 0.0011
Further Details:      
 
Domain Number 4 Region: 924-1074
Classification Level Classification E-value
Superfamily C-type lectin-like 2.23e-33
Family C-type lectin domain 0.00048
Further Details:      
 
Domain Number 5 Region: 791-917
Classification Level Classification E-value
Superfamily C-type lectin-like 2.87e-33
Family C-type lectin domain 0.00036
Further Details:      
 
Domain Number 6 Region: 625-775
Classification Level Classification E-value
Superfamily C-type lectin-like 3.71e-29
Family C-type lectin domain 0.00063
Further Details:      
 
Domain Number 7 Region: 4-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.36e-25
Family Cysteine rich domain 0.0042
Further Details:      
 
Domain Number 8 Region: 1092-1216
Classification Level Classification E-value
Superfamily C-type lectin-like 1.52e-24
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 9 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 1.31e-20
Family Fibronectin type II module 0.00079
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020677
Domain Number - Region: 1220-1260
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00296
Family C-type lectin domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020677   Gene: ENSSTOG00000029005   Transcript: ENSSTOT00000029526
Sequence length 1261
Comment pep:known_by_projection scaffold:spetri2:JH393351.1:3461973:3486332:1 gene:ENSSTOG00000029005 transcript:ENSSTOT00000029526 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLLESDVFLIFSHGLQGCLESQGAQVRVTPACNTSLPAQRWKWVSRNRLFNLGTMQCLGT
GWPGTNTTTSLGMYECDREALSLRWHCRTLGDQLSLFLGGRAGNASKPGTLERGDQTRSG
QWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATAEPTPPDRWANVKVECEPSWQPFQGHCYRL
QAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWS
DGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAE
EDHGCRKGWTWHSPSCYWLGEDQVTYSEARRLCTDHGSQLVTITNRFEQAFVSSLIYNWE
GEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCT
TFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWASDPKLRYCYKVFSSERLQDKKS
WIQAQGACQELGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQHWFWIGLNRRDPGGG
QSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGVDV
RDPDISPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQADLTSVHSQAELDFLGHTL
QKFSRGQEQHWWIGLHTSEGDGRFRWSDGSIINFISWAPGKPRPIGKDKKCVYMTASRED
WGDQKCLTALPYICKRSNSTRETQPPDLLPAAQGGCPSGWNQFLNKCFRIQGQDPQDRVK
WSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVNFDLWIGLHASQRDFQWVEQEPLLYA
NWAPGEPSGPSPAPSGNKPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKGTDLSLS
PSPAASPPAPGAELSYLNGTFRLLQKPLRWHDALLLCESRNASLARVPDPYTQAFLTQAA
RGLRTPLWIGLASEEGSRRYSWVSEEPLSFVGWQEGEPQQPGGCAYVDVDGAWRTTSCDT
KLQGAVCGVSRGPSPPRRINYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQ
R
Download sequence
Identical sequences ENSSTOP00000020677

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]