SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020778 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020778
Domain Number 1 Region: 2-346
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.02e-43
Family Quinoprotein alcohol dehydrogenase-like 0.038
Further Details:      
 
Domain Number 2 Region: 1346-1432,1621-1766,1824-1892
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.84e-41
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 616-961
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-41
Family WD40-repeat 0.0013
Further Details:      
 
Domain Number 4 Region: 892-1203
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.03e-35
Family WD40-repeat 0.0099
Further Details:      
 
Domain Number 5 Region: 260-531
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 1.77e-31
Family All0351-like 0.048
Further Details:      
 
Domain Number 6 Region: 1344-1651
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.48e-28
Family WD40-repeat 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020778   Gene: ENSSTOG00000021646   Transcript: ENSSTOT00000028804
Sequence length 1894
Comment pep:known_by_projection scaffold:spetri2:JH393301.1:1254546:1405364:1 gene:ENSSTOG00000021646 transcript:ENSSTOT00000028804 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSLALHPDKTLIATGQVGKEPYICIWDSYNVQTVSILKDVHTHGVACLAFDSDGQRLASV
GLDAKNTVCIWDWRKGKLLASATGHSDRIFDISWDPYQPNRVVSCGVKHIKFWTLCGNAL
TAKRGIFGKTGDLQTILCLACAKEDVTYSGALNGDIYVWKGLNLVRTIQGAHSAGIFSMY
ACEEGFATGGRDGCIRLWDTDFKPITKIDLRETEQGYKGLSIRSVCWRADRLLAGTQDSE
IFEVIVRERDKPMLILQGHCEGELWALALHPKKPLAVTGSDDRSVRLWSLADHALIARCN
MEEAVRSVAFSPDGSQLALGMKDGSFIVLRVRDMTEVVHIKDRKEVIHEMKFSPDGSYLA
VGSNDGPVDIYAVAQRYKKIGECNKSLSFITHIDWSLDSKYLQTNDGAGDRLFYKMPSGK
PLTSKEEIKGIPWASWTCVKGPEVSGIWPKYTEVTDINSVDANYNSSVLVSGDDFGLVKL
FKFPCLKKGAKFRKYVGHSAHVTNVRWSHDCQWVLSTGGADHSVFQWRFIPEGVSNGMLE
TAPQENSLSEESGHSPPCHGDVPRCCPDRQVAATVHLREEVYKEDLPQLKQQSKEKNHAM
PFLKREKAPEDSLKLQFIHGYRGYDCRNNLFYTQAGEVVYHIAAVAVVYNRQQHSQRLYL
GHDDDILSLTIHPVKDYVATGQVGRDAAIHVWDTQTLKCLSLLKGQHQRGVCALDFSADG
KCLVSVGLDDFHSIVFWDWKKGEKIATTRGHKDKIFVVKCNPHHVDKLVTVGMKHIKFWQ
QAGGGFTSKRGIFGSAGKLETMMCVSYGRMEDLVFSGAATGDIFIWKDVLLLKTVKAHDG
PVFAMYALDKGFVTGGKDGIVELWDDMFERCLKTYAIKRAALSTSSKGLLLEDNPSIRAI
TLGHGHILVGTKNGEILEIDKSGPMTLLVQGHMEGEVWGLAAHPLLPICATVSDDKTLRI
WELSSQHRMLAVRKLKKGGRCCAFSPDGKALAVGLNDGSFLVVNADTVEDMVSFHHRKEM
ISDIKFSKDTGKYLAVASHDNFVDIYNVLTSKRVGICKGASSYITHIDWDSRGKLLQVNS
GAKEQLFFEAPRGKRHIIRPSEIEKIEWDSWTCVLGPTCEGIWPVHSDVTDVNAASLTKD
CSLLATGDDFGFVKLFSYPVKGQHARFKKYVGHSAHVTNVRWLHNDSVLLTVGGADTALM
IWTREFVGTQESKLVDSEESDTDAEEDGGYDSDVAREKAIDYTTKIYAVSIREMEGTKPH
QQMKEVSMEERPPVSRAAPQPEKLQKNNITKKKKLVEELALDHVFGYRGFDCRNNLHYLN
DGADIIFHTAAAGIVQNLSTGSQSFYLEHTDDILCLTVNQHPKYRNVVATSQIGTTPSIH
IWDAMTKHTLSMLRCFHSKGVNYVNFSATGKLLVSVGVDPEHTITVWRWQEGAKVASRGG
HLERIFVVEFRPDSDTQFVSVGVKHMKFWTLAGSALLYKKGVIGSMEAAKMQTMLSVAFG
ANNLTFTGAINGDVYVWKDHFLIRLVAKAHTGPVFTMYTTLRDGLIVTGGKERPTKEGGA
VKLWDQEMKRCRAFQLETGQLVECVRSVCRGKGKILVGTKDGEIIEVGEKNAASNILIDG
HMEGEIWGLATHPSKDIFISASNDGTARIWDLADKKLLNKVNLGHAARCAAYSPDGDMVA
IGMKNGEFVILLVNSLKVWGKKRDRKSAIQDIRISPDNRFLAVGSSEHTVDFYDLTQGTS
LNRTGYCRDIPSFVLQMDFSADSKYIQVSTGAYKRQVHEVPLGKQVTEAMVIEKITWASW
TSILGDEVIGIWPRNADKADVNCACVTHAGLNIVTGDDFGLVKLFDFPCTEKFAKHKRYF
GHSAHVTNIRFSYDDKYVVSTGGDDCSVFVWRCL
Download sequence
Identical sequences ENSSTOP00000020778

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]