SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000020791 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000020791
Domain Number 1 Region: 1172-1349
Classification Level Classification E-value
Superfamily AbfB domain 0.0000000602
Family AbfB domain 0.025
Further Details:      
 
Domain Number 2 Region: 734-791
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000621
Family BSTI 0.056
Further Details:      
 
Domain Number 3 Region: 377-436
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000294
Family ATI-like 0.018
Further Details:      
 
Domain Number 4 Region: 832-900
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000523
Family ATI-like 0.023
Further Details:      
 
Domain Number 5 Region: 1360-1413
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000883
Family BSTI 0.053
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000020791
Domain Number - Region: 893-939
Classification Level Classification E-value
Superfamily FnI-like domain 0.00105
Family VWC domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000020791   Gene: ENSSTOG00000019523   Transcript: ENSSTOT00000020508
Sequence length 1653
Comment pep:known_by_projection scaffold:spetri2:JH393508.1:1173266:1270864:1 gene:ENSSTOG00000019523 transcript:ENSSTOT00000020508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPWGTFLLHILLFSLQGYICVSSILMGTSKNEFNENRQKRALLAAQLEATSPRYFFHEA
INWGESKIKGSCPHECLNGAFCSKTGTCDCQIFQALGTRCQIIPNMGIGRDGICKTWGQY
HFETFDGIYYYFPGTCSYIFAKDCGNLEPRYTVWVHNSPRCFGSVYTCYRSISLFFSNQE
EIRIYGHEIKKDGISLTLPQTIGQVFIEKLADYILVKTTFGFSLAWDGISGIYLKLSEEH
SGKSCGLCGNHNDIQSDDFIIQQEDYTEDIAMFANSWLVQTSEDTKCVPTPSDFPNPCSS
GMPAFEAIFFKCQILLQFPFLSCHEYIDPYLYIASCVNDLCKTDDDETYCRAATEYARAC
SHAGYPIQDWRDDFPACTDKCDDSFVHRDCISCCPPTCTFEKQCLGSNLHCLDGCYCPDG
LIMDNGTCISLENCPCSFHGLAYAVGSKIEQECTECVCVGGVWNCTEHDCPVQCSVVGDS
HFTTFDGRHYSFIGMCQYILVKGTGKDKFTITLQKAPCEQNLGLVCLQSITLILEDDFNK
QVTLSRGGQILTSPNQGFNLKGIVEIQTLSSLFILLKTTFGLKILFAIDGERIYIQLTSA
WKRRTLGLCGTFNGNIRDDFLSPSGMIEGTPQLHANAWRVSSTCFAPVHVPMVDPCNINQ
QNIGYAAHCDVIHQELFASCHIYVSPGLYYQLCRHDACKCGSPCLCNALAHYAYLCGQRG
VPIDFRAQISFCAVVCQKGMLYHHCSSFCRHSCTSLSSPEQCNDDCAEGCNCPEGKFYED
TLNFCVPIYHCRCHYRGSVYQPGELIPTPSGLCQCSNGTVQCDESATPSTVHACPEGKEY
FDCRFPHPELPAGGVNCETTCANLAMNFTCAPSSPCISGCVCAPGMAEHKGKCYVPESCP
CIWKDWEYLSGEVIATPCYTCVCRRGMFNCTYYPCPAVCTIYGDRHYHSFDGLEYDYISD
CQVFLIKSTDDSDISVIAQNKKCFDNDIVCSKSVLISVGDTEIYLNDTPYKQKRSGFFLE
SKPRYQLWKAGHYTVVYFPEKDITILWDKKTTIHIKVGPQWKNKLSGLCGNFDKCTSNDM
TTSNNLEVRNAQVFGDSWALGQCEDPSETIKPCEAHQNKFPYAKKECSILYSDVFAPCRN
VIDVTSFAKNCHEDTCNCNLGGDCECLCTNVAAYAYKCCQEGVSVSWRSSTVCSLDCEYY
NEGLGEGPYMLASYGQSGLILGANMTSRSIFSLPRSSMHGNLFFNFMITPGLFKEKASCN
FLFTGFHYSLSKYLFYVLDIFLASLKSTNMTLTHETLSVLHNNLFIYAFELYSKKGFFIT
FTDSSVKASKYDDSEEFKQSSSFSIEEIQAAVPYRRMCEWRYEPCASPCFKTCSDPEALA
CKFLPPVEGCLPYCPKNMILDEVTLKCVYPGDCIPVIPTEPTLVPPDITVFDTLMPTTGL
ECEPQQFDPVYNCSQYICLNMEWTLYNWSLNCPKEVEMPDCGFRGRPVQVNTDICCPEWE
CPCRCSMLSELSIITFDGNNAALYSMASYILVRIPGEIIVVHIEKCSLNQNGNSFKKLAS
SGRISGLCFKKLNVTTSVNKILVNRVARKVEVDSIVVPLPFSNQELFIEDSGTMYMITTP
AGLIIKWAHLTGIIDIHFSFRFNLSSYTEGLCG
Download sequence
Identical sequences ENSSTOP00000020791 ENSSTOP00000020791

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]