SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021354 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021354
Domain Number 1 Region: 24-159
Classification Level Classification E-value
Superfamily dUTPase-like 3.27e-49
Family dUTPase-like 0.000000212
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021354   Gene: ENSSTOG00000025343   Transcript: ENSSTOT00000020914
Sequence length 164
Comment pep:novel scaffold:spetri2:JH393281.1:8287175:8287669:-1 gene:ENSSTOG00000025343 transcript:ENSSTOT00000020914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSSEEVTAISPSKRARPAEDGGFRLRFVRLSEHAMAPTRGSARAAGYDLYSAYDYIVPP
MEKALVKTDIQIALPSGCYGRIAPRSGLAAKYFIDVGAGVIDEDYRGNIGVVLFNFGKEK
FEVKKGDRIAQLICERIFYPDIEEVQVLNDTERGSGGFGSTVKN
Download sequence
Identical sequences ENSSTOP00000021354 ENSSTOP00000021354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]