SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021364 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021364
Domain Number 1 Region: 11-166
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.75e-83
Family Hedgehog (development protein), N-terminal signaling domain 0.000000076
Further Details:      
 
Domain Number 2 Region: 171-317
Classification Level Classification E-value
Superfamily Hedgehog/intein (Hint) domain 1.2e-40
Family Hedgehog C-terminal (Hog) autoprocessing domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021364   Gene: ENSSTOG00000027440   Transcript: ENSSTOT00000020803
Sequence length 379
Comment pep:known_by_projection scaffold:spetri2:JH393379.1:1475434:1480568:-1 gene:ENSSTOG00000027440 transcript:ENSSTOT00000020803 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFK
DEENTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVD
ITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVHCSVKSEHSAAAKTGGCFPAGAQVRL
ESGARVALSAVKPGDRVLAMGEDGNPTFSDVLIFLDREPNRLRAFQVIETQDPPRRLALT
PAHLLFTADNHTEPVARFRATFASHVQPGQYVLVAGVPGLQPARVAAVSTHVALGAYAPL
TRHGTLVVEDVVASCFAAVSDHRLAQLAFWPLRLFPSLAWGSWTSGEGVHWYPQLLYRLG
RLLLEEGSFHPLGVSGAGS
Download sequence
Identical sequences I3NAG7
ENSSTOP00000021364 ENSSTOP00000021364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]