SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021452 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021452
Domain Number 1 Region: 336-393
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000000144
Family BSTI 0.064
Further Details:      
 
Domain Number 2 Region: 700-761
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000157
Family ATI-like 0.074
Further Details:      
 
Domain Number 3 Region: 800-862
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000785
Family ATI-like 0.024
Further Details:      
 
Domain Number 4 Region: 4473-4530
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000154
Family BSTI 0.025
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000021452
Domain Number - Region: 386-457
Classification Level Classification E-value
Superfamily FnI-like domain 0.000314
Family Fibronectin type I module 0.077
Further Details:      
 
Domain Number - Region: 1174-1226
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000545
Family BSTI 0.071
Further Details:      
 
Domain Number - Region: 4779-4862
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.000902
Family Gonadodropin/Follitropin 0.021
Further Details:      
 
Domain Number - Region: 3365-3395
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00867
Family ATI-like 0.041
Further Details:      
 
Domain Number - Region: 862-902
Classification Level Classification E-value
Superfamily FnI-like domain 0.0157
Family Fibronectin type I module 0.062
Further Details:      
 
Domain Number - Region: 1234-1268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0544
Family Fibronectin type I module 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021452   Gene: ENSSTOG00000027330   Transcript: ENSSTOT00000023381
Sequence length 4862
Comment pep:known_by_projection scaffold:spetri2:JH393626.1:129926:209175:1 gene:ENSSTOG00000027330 transcript:ENSSTOT00000023381 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVGRRKLAPLWALAFALACTRHPGQAQQGSLQPGREPSADLSPLPGHSGDPLLRMTDTP
PLSTIPVVQAPNPAHNGRVCSTWGDSHYKTFDGDIFRFPGLCNYVFSAHCGAAYEDFNVQ
LRRSRAANTTTLSRVIMKLDGLVIELNESSVLVNGHPVQLPFSQSGVLMERSNGNLKVTA
RLGLVFMWDQDDDSLLLELDSKFANQTCGLCGDFNGIPVFNEFLSHDVRLTPMEFGNLQK
MDGPTEQCQDPDPAPQNCSISSGICEELLRGQLFSGCAALVDVSSYVEACRQDLCLCEQA
DLPSCICHTLAEYSRQCAHAGGLPQDWRGPDLCYQTCPLNMQHQECGSPCTDTCSNPQRS
QLCEDHCVAGCFCPEGTVFDDIGQTGCVPMSQCSCMYNGTSYAPGANYSTDCTRCTCSGG
RWSCQEVPCQGTCSVLGGSHLSTFDEKQYTVHGDCSYVLTKPCHDDAFTVLAELRRCGLT
ESETCLKGVELRLGGGPTAVVVKASGEVFVNQIYTQLPVSTANVTLFRPSTFFIIAQTHL
GVQLAIQLVPTMQVFVRLAPELRGLTCGLCGNFNSIQADDFRTNSGVVEGTGAAFANTWK
TQAACPNAKSSFEDPCSLSVENEKYAQHWCSQLTSPDGPFAQCHATVSPSTYYSNCMFDT
CNCEKSEDCMCAALSSYVQACAAKGVLLRGWRAGVCTKPTTTCPKSMTYHYHISTCQPTC
RALSEEDVTCHVSFVPVDGCACPEGMFLDASDKCVPAASCPCYHRGSMVPNGESLHDSGA
VCTCTQGTLTCIGGPAPTQVCDAPMVYFDCHNATHGATGAGCQKSCHTLDMACYSPQCEP
GCVCPPGLVADGSGGCIAAEDCPCMHNGASYRPGETIWAGCNTCTCENRMWRCTEEPCQA
TCALYGDGHFLTFDGQRYTFSGDCQYTLVQDHCGGNGSAKDAFRVVTENVPCGTTGTTCS
KDIKIFLGSYELKLSSGKVEVVQKGAGQEPPYTIRQMGIYLVVDTDAGLVLLWDRRTSIF
LRLSPEFKGRVCGLCGNFDGNALNDFTTRSQAVVGDALEFGNSWKLSPSCPDALVPKDPC
TTNPYRKAWAQKQCSIIHSATFATCHAHVEPTMYYEACVGDACACDSGGDCECFCTAVAA
YAQACHEAGVCVSWRTPDVCPLFCDYYNPQGECEWHFQPCGAPCMRTCRNPSGRCLHDLR
GLEGCYPKCPPSAPIFDEDKMQCVDKCPTPTPPPPCRIHGKSYRPGATVPSDKNCYSCIC
TENGVHCAYDSGACVCTYDGRHFHPGDVIYNTTDGMGSCISAHCGANGTVERRVFTCSPS
TPRPPTTFSFSTSPHSVGSSPTQSTVHPVPVSTASSTATGTPLRTTPATPPVSSSVHCGE
KCLWSPWLDVSRPGQGVDSGDFDTLQNLRAHGFRICQVPRAVQCRAEDAPEVPLQALGQR
LECSPTAGLTCHNRDQASGLCHNYQIRVLCCSPLPCPTSSPPARHRTTNTVPMTSATVSS
TPVRTSFLKSSPTPKTTSGTPSASASPPGRSQVTSVPTTSGVSPVSCLRESCTWTQWMDG
SYPGPGKDSGDFDTFHNLRSKGYKFCERPTSVECRAQFFPNTPLAELGQQVTCNSEEGLI
CWNRDQLPPICYNYEIRIQCCELVDDCRNETIGTPKSIATHPKSTEGSTTTKTTVTTGSQ
ATSTGHTTHPTPVHTSRGTSVGTKVTQSQTTDCQPQCTWTKWFDVDFPDPGPHGGDTETY
SNILSKGERICLQPEDITRLECRAECRNQEQQGPLGMCLNYEVRVLCCHTPDGCPTTGTP
AWTTPPEPSSSVPSTSAVSSPWSPSSAASSTLPCFCSVLDQLYPAGPQGLSLWASREGPI
PGIRPCSCPCFCRKARPGPCQTAPRPPARATASSPCVHASVQSVSWGPGGGQQRGWNWVR
LQAEHVSHKAGMGVVETRTLGCPGKPAEPLGPARWDKAIIVEYHQDRVVLTRTPVGGVMT
NQKCRSAPLPTIPRGSVVSLPGDLGSRLVGWGSRVGSLGAHPFTLREPPRVGFSEDSAAR
EGGAWAGPTGEGGDVWPDPARTTGRCRAQSPWSSSLTPSVWPGTCTNDKRDECRLPGGTV
APSCSAMSGHWKVDVPGQPHCHGPPGGHCRNATPGLGCSQAGQPEGLCCPLSRMQALVTS
PAPGDGEPGGEALAPRGTASSWPSGWHLSLQPSPARLARCTCPVARPASPTATGRTAPAP
CTCTLTPPTVGPTESRAPPGGPLPGQGTAARGAGAAAHSTFLQGPPGATPKSVCLPTAAV
RPQGLVLSPCLAMSSSPWTPSILTGQATPQSPSHLISSPPGVSRTSANLSSCHSECCPRC
PPRAPPCEPAWAQADLWQAHTSLLCSRATPSAPTARSAPARVTACVPPGQAESAAMSTAL
STRADPPQTTSQNPARTREPSLHGPGLQPAVRPRSATPTAPCSDSSPGGPGNKAAAARPH
LCASPTARGTAGTAPPCTGPLSVAPSPIHGTPWTPTRWNASASAARSCGPHVTPATQDHR
SLSPRRAKSRARSQGAVAGRDCPGLPSELASAAVSSGTHQGKRPLNPPSHSAPVTPGPLL
RKTLCPRASWSLADLTQPWPPGVRARALRPRSHPGRAACFHPERGVPLQAQGHLRGSQAG
SQEPGALTVPRRGQSLCLHLKTQLSQSPKRCWWDRGEEGTPSAEVGRASGPSATCSGWLC
PKTAGPPSSSPLSPPRLTLGSMSTGSYGSGPSWPPTGSFFKSRRAYGGTCVHSTTDEDPT
SQPRPSQLLTSHTGPPRAAHQTRQWEGHVTTWCSASWGSCPTLGISKSLWETLGTTRPAA
PSACLCYSSCLPGHLTHTPVASPDTHERVWKSRPCPRPAAPTWNSWETADPASAGARRGR
ETRLKLAERGDQEIKLPQEGTSTQTRGRLSPKPEDGQLGLELRPCGDESRAMCPPEALCS
PLCLGSEARMMDRDSPQAGPGSTVRATGVKPCASQGALPAAQGSSTQEARESQRSVTAVA
DGVSWTLQRDSVYLPSSSAWPVVFPPTTIMPNTSCKTGPTTGGCAAPGATSTTRPSTGTS
SASPACATTCSLPTVELPTRTSTCRCAAAWQAPVPPSAALSSRPRGWCWSCPTALSLSMD
SGMPTRHVGCAETSTGSQPAMNSLSTGPGTSVPSQPRANSPRKPSSTHTPSPLLLSLQLY
PHTISPAPEPSSTHTPSPLLLSLQLYPHTISPAPEPAALPTLCFLSGRHQAEPSPVWKAG
SPTPTSRTEWAWICATAPHAPVLPLPSIPASVPKQGASHRTGGAPNSAVSAPHRAQGIHW
EPVPGIWLERQQGRNGYSGAPKRGASKERGRWQDSCGDNTEVKPRGLGAQREDLDLRHSE
QTCVRTSGHDTCSNPQRSQLCEDHCVAGCFCPPGRPVPLAPPSGQDAPSPVLTSPLIPSQ
AWCWTTSRTLAACLWHSAPAPTAATPTCPGPPLLPPAAPGGPPALTGTRRHTMSTETAAT
FCPRCGPGRASGPLSPPTLLTHMPSPNRNVPTAASLCWPSCGNAAGQTQRTVSEETKLMT
SWPSVAWWKAQVPPSPTPGRPRLPAPMPRTSSRTPAHSMTSSSVPNRRWGVGPGGQPLTC
PSPLPTQVCPCQIFLCPIPSPKGSETQRDQAGGGHLPGPLPRAMSQRAPQGSSASGAATP
WTWTVRTVPVSTMRHPTSRGPPSGSTATPGPHSVEKGPGSLTQGTAGGSAAASPAWAPVW
PTGMATLSPLMASATASKAAANTPWPRTTVGAMAAPAGLSASPLRTSPVGPQELPAPRPS
DSSWGAGSAACVGTSTAMPSMTSPHGARPWTPVPPTLTARPGPRSSAASSTVPPSPPATL
RSPQPRTARAGEAGDGGGTVTAPLVASSALTVPRVRKGCWVGLGLGTVPTASTTPSPGTS
TMKPQSTTLGTCQSQCEWTEWFDTDYPKSEEDGGDIESYDRIRAMGGSICEHPQDIECET
DLYPGKSPETLGQQVKCDIHYGLECHNKDQKGLFPMCYNYRLRVLCCGTSHCTETASKSP
LTTVPRNTTKSTHTQGVPSTPGPTSVLGSTVLVSTRTLPEPCFCQAFGGLFSPGEFIYNK
TDRAGCNFYAICTQECGIERFHGTCPTSSPTMSSIPVPPPSPPLGCDNAVPPRQVNESWT
LENCTVARCEGNNRVILLEPSPVASITCVNQHMPIKVWSQSQPCLFHYECECFCSGWGHW
NFMTFDGTSYSFRGNCTYTLMREIHPRHGNLSILIDNHHCRAHDTASCPQALRVHYESTE
IILTTTNTSAGEESLILFNQMRVSRGFSRNGISVSVTGAITMGVHIPAVGVSITFNGHTF
QIQLSYGYFGHNTEGQCGTCTNSQSDDCRRPDGTIAPTCQDMAKTWVVPDSSREDCQAVP
NLPVTTSPPPPVYSTTSSTPCPISPLCKLMLSGVFAECHSLIPPGPFFHTCVSDSCQADT
LMLCQNLEAYAALCRSRDVCVDWRNATSGLCDHPCPPTKMYRPCGPMQPAACDSRTHSPL
SSRLAEGCFCPENQLLFSLSTDICVPECSCVGPDGSPKFLGEQWISNCQSCVCDEGSASV
RCKPVQCEVQDLPLQCGQPGFMALTRPQANNPCCSETLCVCNVTNCPQDPPECGPGQELT
YTQEQSSCCPNFSCRPKLCNYNGTVYGVGATFPGVIPCHTCICVSMGAQAPTVQCKEVAC
TTSCPQGFEYSRSDRQCVPITCFTPEGQSVQPNETWVSSHVDNCTEYRCETKSGFPVLTP
RPKPCPDVSNCSLAAATPVRKGVSRGSFLPPPVLPNDSYSCQVRGTLTILRYQGCETETV
VNVSFCEGSCPGVSKYSMEAQAMQQKCTCCQERRTHQEAVIMRCPNGTDIQHTYTQVDEC
SC
Download sequence
Identical sequences ENSSTOP00000021452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]