SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021457 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021457
Domain Number 1 Region: 180-418
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.49e-51
Family Voltage-gated potassium channels 0.001
Further Details:      
 
Domain Number 2 Region: 17-129
Classification Level Classification E-value
Superfamily POZ domain 1.41e-29
Family Tetramerization domain of potassium channels 0.00055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021457   Gene: ENSSTOG00000024646   Transcript: ENSSTOT00000021385
Sequence length 477
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:44457902:44459335:-1 gene:ENSSTOG00000024646 transcript:ENSSTOT00000021385 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGQSLWDLSEANVEDGEIRINVGGFKRRLRSHTLLRFPETRLGRLLLCHSREAILELCD
DYDDVQREFYFDRNPELFPYVLHFYHTGKLHVMAELCVFSFSQEIEYWGINEFFIDSCCS
YSYHGRKVEPEQEKWDEQSDQESTTSSFDEILAFYNDASKFDGQPLGNFRRQLWLALDNP
GYSVLSRVFSILSILVVLGSIITMCLNSLPDFQIPDGQGNPGEDPRFEIVEHFGIAWFTF
ELVARFAVAPDFLKFFKNALNLIDLMSIVPFYITLVVNLVVESTPTLANLGRVAQVLRLM
RIFRILKLARHSTGLRSLGATLKYSYKEVGLLLLYLSVGISIFSVVAYTIEKEENEGLAT
IPACWWWATVSMTTVGYGDVVPGTTAGKLTASACILAGILVVVLPITLIFNKFSHFYRRQ
KQLESAMRSCDFGDGMKEVPSVNLRDYYAHKVKSLMASLTNMSRSSPSELSLNDSLH
Download sequence
Identical sequences I3NAR0
ENSSTOP00000021457 ENSSTOP00000021457 XP_005316366.1.77405 XP_015341958.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]