SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021535 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021535
Domain Number 1 Region: 22-76
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000746
Family HLH, helix-loop-helix DNA-binding domain 0.0042
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000021535
Domain Number - Region: 86-125
Classification Level Classification E-value
Superfamily Orange domain-like 0.000196
Family Hairy Orange domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021535   Gene: ENSSTOG00000020897   Transcript: ENSSTOT00000024683
Sequence length 171
Comment pep:known_by_projection scaffold:spetri2:JH393547.1:1045718:1047142:1 gene:ENSSTOG00000020897 transcript:ENSSTOT00000024683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VTTNSSSGKVLSPGDRLGAGNRGRVPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKL
EKADILEMAVSYLKHSKAFAAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLL
YHFQRPSAGSTAPAKEPQASSAVAPPVRSSVKAAATAAAARQPACGLWRPW
Download sequence
Identical sequences ENSSTOP00000021535 ENSSTOP00000021535

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]