SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021662 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021662
Domain Number 1 Region: 21-229
Classification Level Classification E-value
Superfamily PHP domain-like 1.96e-45
Family RNase P subunit p30 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021662   Gene: ENSSTOG00000027002   Transcript: ENSSTOT00000019538
Sequence length 268
Comment pep:known_by_projection scaffold:spetri2:JH393411.1:3517648:3549151:-1 gene:ENSSTOG00000027002 transcript:ENSSTOT00000019538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVFADLDIRAGSDLKALRGLVETAAHLGYSVVAINHVVDFKEKKQEIEKPIAISDLFPT
FPIVQGKSRPIKILTRLTIIVTDPSHCNVLRATSSRVRLYDIVAVFPKTEKLFHVACTHL
DVDLVCITVTEKLPFYFKRPPINVAIDRGLGFELVYSPAIKDSTMRRYTISNALNLMQIC
KGKNIIISSAAERPLEIRGPYDVANLGLLFGLSESDAKAAVSTNCRAALLHGETRKTAFG
IISTVKKPRPSEEGDDSLPACKKAKCES
Download sequence
Identical sequences I3NBB5
XP_005333797.1.77405 ENSSTOP00000021662 ENSSTOP00000021662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]