SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021787 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021787
Domain Number 1 Region: 2077-2236
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.84e-21
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.0055
Further Details:      
 
Domain Number 2 Region: 2549-2606
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000126
Family TSP-1 type 1 repeat 0.00043
Further Details:      
 
Domain Number 3 Region: 2979-3036
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000968
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 4 Region: 2712-2763
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000275
Family TSP-1 type 1 repeat 0.00078
Further Details:      
 
Domain Number 5 Region: 4011-4068
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000575
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 6 Region: 3253-3302
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000746
Family TSP-1 type 1 repeat 0.00047
Further Details:      
 
Domain Number 7 Region: 4260-4315
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000011
Family TSP-1 type 1 repeat 0.0009
Further Details:      
 
Domain Number 8 Region: 3816-3874
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000262
Family TSP-1 type 1 repeat 0.00075
Further Details:      
 
Domain Number 9 Region: 2823-2879
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000353
Family TSP-1 type 1 repeat 0.00054
Further Details:      
 
Domain Number 10 Region: 3645-3688
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000157
Family TSP-1 type 1 repeat 0.00073
Further Details:      
 
Domain Number 11 Region: 3952-4011
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000654
Family TSP-1 type 1 repeat 0.0014
Further Details:      
 
Domain Number 12 Region: 1574-1612
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000017
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 13 Region: 1707-1757
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000222
Family TSP-1 type 1 repeat 0.00092
Further Details:      
 
Domain Number 14 Region: 3470-3519
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000235
Family TSP-1 type 1 repeat 0.0011
Further Details:      
 
Domain Number 15 Region: 1423-1464
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000034
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 16 Region: 2496-2549
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000471
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 17 Region: 1282-1345
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000497
Family ATI-like 0.062
Further Details:      
 
Domain Number 18 Region: 4623-4676
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000785
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 19 Region: 466-528
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000105
Family BSTI 0.05
Further Details:      
 
Domain Number 20 Region: 3085-3142
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000111
Family ATI-like 0.046
Further Details:      
 
Domain Number 21 Region: 4779-4829
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000012
Family TSP-1 type 1 repeat 0.00098
Further Details:      
 
Domain Number 22 Region: 1823-1883
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000144
Family BSTI 0.067
Further Details:      
 
Domain Number 23 Region: 3184-3244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000144
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 24 Region: 2458-2495
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 25 Region: 1387-1423
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000017
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 26 Region: 4831-4888
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000183
Family BSTI 0.033
Further Details:      
 
Domain Number 27 Region: 1762-1815
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000196
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 28 Region: 1463-1506
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000262
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 29 Region: 829-889
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000000474
Family ATI-like 0.054
Further Details:      
 
Domain Number 30 Region: 4991-5058
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000502
Family VWC domain 0.079
Further Details:      
 
Domain Number 31 Region: 3404-3460
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000641
Family TSP-1 type 1 repeat 0.00072
Further Details:      
 
Domain Number 32 Region: 1503-1541
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000107
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 33 Region: 4936-5001
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000144
Family ATI-like 0.015
Further Details:      
 
Domain Number 34 Region: 2400-2439
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000196
Family LDL receptor-like module 0.0022
Further Details:      
 
Domain Number 35 Region: 4166-4221
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000366
Family TSP-1 type 1 repeat 0.0019
Further Details:      
 
Domain Number 36 Region: 2240-2279
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000367
Family LDL receptor-like module 0.0023
Further Details:      
 
Domain Number 37 Region: 3316-3367
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000687
Family BSTI 0.023
Further Details:      
 
Domain Number 38 Region: 2629-2674
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000144
Family ATI-like 0.02
Further Details:      
 
Domain Number 39 Region: 4433-4491
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000445
Family ATI-like 0.012
Further Details:      
 
Domain Number 40 Region: 3889-3937
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000615
Family TSP-1 type 1 repeat 0.0017
Further Details:      
 
Domain Number 41 Region: 930-984
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000634
Family ATI-like 0.049
Further Details:      
 
Domain Number 42 Region: 4323-4373
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000654
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 43 Region: 4068-4127
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000867
Family BSTI 0.027
Further Details:      
 
Domain Number 44 Region: 1615-1650
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000982
Family LDL receptor-like module 0.0033
Further Details:      
 
Domain Number 45 Region: 2771-2819
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000101
Family TSP-1 type 1 repeat 0.0016
Further Details:      
 
Domain Number 46 Region: 1919-1977
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000129
Family TSP-1 type 1 repeat 0.0012
Further Details:      
 
Domain Number 47 Region: 4690-4739
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000131
Family ATI-like 0.085
Further Details:      
 
Domain Number 48 Region: 897-925
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0000249
Family PMP inhibitors 0.0021
Further Details:      
 
Domain Number 49 Region: 3041-3080
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000249
Family TSP-1 type 1 repeat 0.0027
Further Details:      
 
Domain Number 50 Region: 982-1023
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000356
Family VWC domain 0.071
Further Details:      
 
Domain Number 51 Region: 2879-2944
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000719
Family ATI-like 0.044
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000021787
Domain Number - Region: 3527-3584
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000311
Family ATI-like 0.043
Further Details:      
 
Domain Number - Region: 3695-3752
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000327
Family BSTI 0.045
Further Details:      
 
Domain Number - Region: 1975-2037
Classification Level Classification E-value
Superfamily FnI-like domain 0.0023
Family VWC domain 0.071
Further Details:      
 
Domain Number - Region: 1667-1693
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0038
Family LDL receptor-like module 0.0041
Further Details:      
 
Domain Number - Region: 5068-5159
Classification Level Classification E-value
Superfamily Cystine-knot cytokines 0.00481
Family Gonadodropin/Follitropin 0.01
Further Details:      
 
Domain Number - Region: 526-566
Classification Level Classification E-value
Superfamily FnI-like domain 0.0115
Family Fibronectin type I module 0.089
Further Details:      
 
Domain Number - Region: 4372-4429
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0144
Family TSP-1 type 1 repeat 0.0051
Further Details:      
 
Domain Number - Region: 4138-4166
Classification Level Classification E-value
Superfamily PMP inhibitors 0.0196
Family PMP inhibitors 0.0029
Further Details:      
 
Domain Number - Region: 4907-4961
Classification Level Classification E-value
Superfamily FnI-like domain 0.0513
Family VWC domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021787   Gene: ENSSTOG00000023004   Transcript: ENSSTOT00000022231
Sequence length 5164
Comment pep:novel scaffold:spetri2:JH393337.1:5824319:5874879:1 gene:ENSSTOG00000023004 transcript:ENSSTOT00000022231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLAVLFGMLWALANGRWCEQTETIHVEEEVAPRKEDLVPCASLYHYTRLGWRLDLPRS
GHEGLSGPPAPGLCRIYKPPETRPATWNRTVRACCPGWGGAQCTDALMEDSPGGHCFATW
QCQPLGGSANTSTENLEECCARPWGHSWWDSGSQLCLSCSSQHFPGNASSAVLLQPLPGA
VGQLWSQHQRFSATCATWSGFHYHTFDGRHYHFLGHCTYLLAGAADSTWAVHLRPRDHCS
QPEHCQLVLVIMGSEEVQIQGRDVSVKGQLIPDGEPQLLHGLSLQWQGDWLVLSGGLGVV
VRLDRSSSVSISVDHEHSGQTQGLCGLYNGRPEDDFSEPGGGLAMLAATFGNSWKLPSSE
PGCLDAVEVDQGCEGPLKGTEAGMDAGQLRAEAQDVCHQLLESPFWQCHAQVSPDEYHEA
CLFAYCAGAALGRQEGRQEAVCATFANYAQACARRRIHVLWRKPGFCERLCPGGQLYSDC
VSSCPPSCSAVGQEEEGSCREECVSGCECPPGLFWDGALCVPASRCPCYHRRQRYAPGDT
VHQLCNPCVCQDGHWHCAQALCPAECAVGGDGHYLTFDGRSFFFRGHSGCHYSLVQRRVP
PQGVQGRGAVGPSHSYPSPSVLAAPSIYLPPPPHHQAPFPGAVLVDGQDVGLPWIGTAGL
SISRASSTFLLLRWPGVHVLWGVADPAAYITLAPHHAHQVQGLCGTFTWNQQDDFLTPAG
DVETSTADFASRFQVAGNGKCSSGDSVLLFPCSTHSQHLAFAEATCAILHGPAFQDCHRL
VDREPFQLRCLAAVCGCAPGRDCLCAVLSAYAHRCAQEGALLSWRNQTLCPVLCPGGQEY
QECAPVCGHHCGEPEDCKELTGCVAGCNCPPGLLWDPEGQCVPPSLCSCQLGAHRYSPGS
VTMKDCNRCICQERGLWNCTAHHCALQRAFCPGELVHAPGACLLTCDSPSANHSCPMGST
DGCVCPPGTVLLDERCVPPDLCPCRHSGQWYPPNATIQDNCNTCVCQGRQWHCTGQLCSG
WCQASGAPHYVTFDGLTLTFPGACEYLLVREASGRFSVSAQNLPCGASGLTCTKTLAVRL
EGTTVHMLRGRAVTVNGVSVTPPKAYTGPGISLHRAGLFLLLTTRLGLTLLWDGVMPPGT
RVLIQLSPHFRGRVAGLCGDFDGDASNDLRSRQGVLEPTAELAAHSWRLSALCPEPGDPP
HPCTVNTHRAAWARARCGVMLQQLFVPCHTEVPPQQHYEWCVYDTCGCDSGGDCECLCSA
IAAYADECARHGHHVRWRSQELCPLQCEGGQVYEACGPTCPPACPTHHAEPAWHCRAIAC
VEGCFCPEGTLLHGGICMEPSACPCEWGGSFFPPGTVLQKDCGNCTCQESQWHCGGDSAP
CEELVPDCAEGESPCQGSGHCIPHEWLCDNQDDCGDGSDEEGCATPGCVEGQMSCRSGHC
LPLSLLCDGQDDCGDGTDEQGCPCPHDSLACADGRCLPLTLLCDGHPDCPDAADEESCLA
GQVNCIPGEVSCMDGTCVGTIQLCDGVWDCPDGADEGPGYCPLPSLPVPPASTMPGPSTG
SLEGASSPLGSASPARSCGPLEFPCGSGECTPRGWRCDQEEDCADGSDELGCGGPCALHH
APCARGSHCVSPGELCDGVPQCPDGSDEGPDACEGLPPPGSLNRTEFPCPEYSCPNGDCL
GFHLVCDGQPNCELVGEAGLSPEEQGCGTWGPWSPWGPCSQTCGLGVQSQSRSCSPSGLL
VLQHCPGPANQSQACFTKACPVDGEWSSWSSWSLCSEPCGGTRTRQRQCHPPQNGGQACA
LLPGGPHSTHQTEPCPQDGCPNATCSGELVFQPCAPCPLTCDDISGQAICSPRRPCSSPG
CWCPEGQVLGSEGQCVWPRQCPCLVDGARYWPGQHIKANCQLCVCQDGRPRRCRPNPDCA
INCGWSSWSPWAECLGPCGSQSIQWSFRSPNNPRLSGRGRQCRGIHRKARRCQTQPCEGC
EQQGHTHQVGERWRGGPCKVCQCLHMGTVHCSPYCPLGSCPQGWILVEGVGESCCHCALP
AENQTVPPTATPAPAPAPSPQTGPPLVTYVLPPLGDACYSPLGLALPPGSLWTWSRQLEP
PTWAALLGAPTKGPGPRAGAYAEWHSGPPFLQLDLLQPRNLTGVIVWGPTSSSPPGSSFS
LQFGTDGLHWQDYRDILPGTLSPPKSFPRNWEDVASKVWAFSRMVQARYIRVWPHSVPHS
DRQPGFFLWVELLGCEPVSPPVPPCPGAGHRCANGDCALRGVPCDGAADCEHGSDEEGCG
PLPVDTGSRGHSTARTPTFSTQPGPLPPQPSEGLAETDRWHPKQGLSMPPTEKRPVSPAP
ASKAPHPSSGESVQTGSNTPTFHAGFQSLTPGMAATTVLPTHPMIPMTPAGQRVAPSPFP
PVRCSPGQLPCKVLGCVEPEQLCDGKEDCLDGDDERHCASPMPFMVPTTVLPGLPASRTL
CSQSQLSCGSGECLPTERRCDLRPDCQDGSDEDGCVDCVLAPWSGWSGCSRSCGLGLTFQ
RRELLRPPLPGGSCPLDQLRRQPCFVQACPVAGAWAEWETWGPCSVSCGGGHQSRQRSCM
DPPPKNGGAPCPGASWERAPCGLQPCTGDTDCGLGRVHVNAELCQKGLVPPCPPSCLDPE
TNGSCTGPCVEGCRCPPGLLLHDSRCLPLSECPCLVGEELKPPGMSFLLDNCSQCICERG
TLVCEPGACPQPCGWSAWSSWTPCDRSCGSGVRARFRSPSNPPAAFGGAPCEGDKQELQV
CHVDCGTEVLGWTPWTSWSSCSQSCLVPGGVPGWRHRSRLCPGLRDTSCPGEATQEEPCS
PPVCPVPSSWGAWASWSACSAPCNGGIQIRGRSCSGSAPGNPACRGPHSQTRDCNTQPCT
AQCPEDMVFRSAEQCHQDGGPCPQLCLAQDSGVECTGFCTPSCTCPPGLFLHNASCLPRS
QCPCQLHGKLYAPGAVARLDSCNNCTCISGEMACTSELCPVACGWSPWTPWSPCSRSCDV
GIRRRFRAGTSPPAAFGGAECQGPNIEAEFCSLRPCQSPGGEWGPWASCSVPCGGGYRNR
TRGSGPRVLMVFSTCNLQPCAGPVPGMCPRGQLWLDCAQGPASCAELSAPRETKQTCHPG
CYCPHGMHLLNNVCVPAQACPCAHEGRLHPPGSAVLRPCENCSCISGLITNCTSWPCEEA
QGQPTWSPWTPWSVCSASCGPARRHRHRFCDRPSSVAPSTLALGPSPATPTPLCPGPEAE
EEPCLLPGCDRAGGWGPWGPWSSCSRSCGGGLRSRTRACDQPPPQGLGDFCEGPQAQGEA
CQAQPCPVTDCTAIEGAQYSPCGPPCPRSCDDLVHCVWHCQPGCYCPPGQVLSADGTLCV
HPGHCGCLDLLTGERHRPGAQLARPDGCNHCTCLEGRLNCSELPCPVPGGWCPWSEWTAC
FQPCRGQTRTRSRACACPAPQHGGALCPGEMGAQHQRETCPSSTTCPGTVDGAWSPWGPW
SPCDACLGQSHRSRECSQPPTSEGGRPCPGVHWQSRPCHDNSTQCADCGGGQSLLPCGQP
CPRSCLDLSPGSVCQPGPGGCQPSCGCPPGQLSQDGLCVLPVHCRCQYQPGAMGIPENQS
RSAGSGLSSWESLEPGEVVTGPCNNCTCVAGILQCWEVPSCPGAGVWGPWGPWEDCSVSC
GGGEQLRSRHCARPPCPGLARQSRTCHTQVCREAGCPAGRLYRECLPNGGCPFSCAHVAG
RVACFSDGCEEGCHCPEGTFQHGLACVQECPCMLTALLLRELGASSTDAGVHAASLGEEG
QPLRPGDELSPGQMFRMGCSNCSCAHGKLSCSIEDCPEAPSFSPWDPWGPCSRSCGGLGT
RTRSRQCVHPALATGGQGCQGPRQDLEYCLSPDCSGAEGSTAEPVTGLPGGWGPWAPWSP
CSRSCTDPTHPAWRSRTRLCLTNCTVGRPSQERPCNLPSCTELQPLCSSPGCGPGNCSWT
SWGPWEPCSRSCGVGQQHRLRAYRPPGPGGHWCPDILTAFQERRFCSLRACPVPGGWSRW
SPWSWCDRSCGGGQSLRSRSCSSPPPKNGGAPCVGEKHHARLCNPMPCEEGCPAGMELVS
CANRCPRRCSDLQEGVLCQDGQACQWGCRCAEGSLEQDSSCVPVGHCECTDAQGHSWAPG
SQHQDACNNCSCQAGQLSCTAQPCPPPAHCAWSRWSAWSPCSHSCGPRGLQSRFRSSTSG
SWAPECQEEQSQSQPCPQPPCPPLCLHEGRVHTLGDSWLQGGCQQCSCTPEGIICEDTKC
PGSWTLWSLWSDCPVSCGGGNQVRTRACVVPDPHHREPLCQGPDTQTQPCGQQPCQPLLE
ACSWGPWGPCSRSCGSGLASRSGSCPCLPAEAEPTCNGTFPHLDTQACYAGPCLEECLWS
GWSSWTRCSCQVLVQQRYRHQGPAPGGTAEGPPCTRLDGHFRPCPTGNCSEDSCTPPFEF
QACGSPCAGLCATHLSRQLCQDLPACQPGCYCPKGLLEQAGACIPPEQCNCWHISEEGAE
VTLAPGDHLQLGCKECECWHGELRCTSGGCAGLLPLSSWSEWSPCGPCLPRSALTRTSRT
TLEEHWPPNTTGLWPPSTSLLVSEQHRHRLCLDPETGRPWAGDPQLCTAPLNQQRLCPDP
EACQDSCQWNPWGPWSPCQVPCSGGFRMRWREAGGLPGGACRGPWAQTQSCNMGPCPGKS
CEAKDTVPTLECANQCPRSCMDLWDRVQCLQGPCSPGCRCPPGQLVQDGHCVPISSCRCG
LPSANASWELAPAQVVQLDCHNCTCINGSLVCPHLECPTLGPWSAWSKCSVACGGGTMDR
HRSCKEHPQGALCQAQDMKQQQDCNLQPCPECPSGQVFSACAASCPSLCSHLQPGTICTQ
EPCQPGCGCPRGQLLHNGTCVPPAACPCTQLLLPWGLTLTLEEQAQELPPGAVLTRNCTR
CTCQDGAFSCSPIDCQECPPGEMWQHVGPEELGPCEWTCQETNTTAAQGNCSAVQTPGCI
CQEGYFRSQAGPCVPADQCECWHHGHLHLLGSEWQEDCESCQCLRGRSVCTRHCPLLNCA
QDEVTVQEPGSCCPTCRRETLDTEAQSASCRHLTELRNLTKGPCHLDQVEVSYCSGHCPS
STNVMPEEPYLQSQCDCCSYRLDPDSPVRILNLQCPDGRTEPVVLPVINSCQCSACQAGD
FSKR
Download sequence
Identical sequences ENSSTOP00000018545 ENSSTOP00000021787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]