SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021874 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021874
Domain Number 1 Region: 1-206
Classification Level Classification E-value
Superfamily Cytochrome P450 3.93e-76
Family Cytochrome P450 0.0000000473
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021874   Gene: ENSSTOG00000020136   Transcript: ENSSTOT00000028462
Sequence length 207
Comment pep:novel scaffold:spetri2:JH398264.1:21:3815:1 gene:ENSSTOG00000020136 transcript:ENSSTOT00000028462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSDLEIAAQSIIFILTGYDTTSNTLSFIMYLLASHPDVQKKLQQEIDETLPNKAPVTYDV
LFEMKYLYMVVNETLRLYPIIERIVRVCKKDVELNEVLIPKGTIVTIPTYSLHQNSTYWP
EPEKFYPERFSKKNKENINLYIYMPFGNGPRNCIGMRFALKSMKLALIRLLQNFFYPCKE
TQIPLKLSKKPFLQPEKPIVLKVVSRD
Download sequence
Identical sequences ENSSTOP00000021874 ENSSTOP00000021874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]