SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022098 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022098
Domain Number 1 Region: 2-117
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.81e-22
Family Laminin G-like module 0.015
Further Details:      
 
Domain Number 2 Region: 282-420
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000212
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 3 Region: 157-221
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000146
Family VWC domain 0.015
Further Details:      
 
Domain Number 4 Region: 577-649
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000377
Family VWC domain 0.01
Further Details:      
 
Domain Number 5 Region: 414-525
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000455
Family Growth factor receptor domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSTOP00000022098
Domain Number - Region: 222-266
Classification Level Classification E-value
Superfamily FnI-like domain 0.0691
Family Fibronectin type I module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022098   Gene: ENSSTOG00000019850   Transcript: ENSSTOT00000021184
Sequence length 705
Comment pep:known_by_projection scaffold:spetri2:JH393322.1:2862096:3116386:-1 gene:ENSSTOG00000019850 transcript:ENSSTOT00000021184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYLELESSGHRNEVRLHYRSGSHRPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKI
YERVVEKPSTDFPLGTTFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTC
NDFHGLVQKIMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKETTYREFESWTDGC
KNCTCLNGTIQCETLICPVPDCPLKSAPAYVDGKCCKECKSICQFQGRTYFEGERNTVYS
SSGVCVLYECKENNMKAVVSSSCPTHQSIQSRVIRLDHNYHNICIGYDFCSERHNCMENS
VCRNLNDRAVCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTG
YIRIDDYSCTEHDECVTNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCKDGCRN
GGACIAANVCACPQGFTGSSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNG
MFSPSGESCEDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKVKHNGQ
IWVLENDRCSVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNS
GDTWVQNCQQCRCLQGEVDCWPLPCPDVECEFSVLPENECCPRCVTDPCQADTIRNDITK
TCLDEMNVVRFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences ENSSTOP00000022098 ENSSTOP00000022098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]