SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022105 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022105
Domain Number 1 Region: 489-725
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.24e-58
Family Eukaryotic proteases 0.0000000115
Further Details:      
 
Domain Number 2 Region: 117-215
Classification Level Classification E-value
Superfamily Kringle-like 2.08e-35
Family Kringle modules 0.00000629
Further Details:      
 
Domain Number 3 Region: 212-294
Classification Level Classification E-value
Superfamily Kringle-like 1.81e-33
Family Kringle modules 0.00019
Further Details:      
 
Domain Number 4 Region: 306-389
Classification Level Classification E-value
Superfamily Kringle-like 6.77e-32
Family Kringle modules 0.00018
Further Details:      
 
Domain Number 5 Region: 384-481
Classification Level Classification E-value
Superfamily Kringle-like 1.04e-27
Family Kringle modules 0.00044
Further Details:      
 
Domain Number 6 Region: 38-127
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 1.53e-21
Family Hairpin loop containing domain 0.00000541
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022105   Gene: ENSSTOG00000003087   Transcript: ENSSTOT00000026212
Sequence length 733
Comment pep:known_by_projection scaffold:spetri2:JH393544.1:356562:428403:-1 gene:ENSSTOG00000003087 transcript:ENSSTOT00000026212 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWVTKLLPVLLLQHVLLHLLLLPIAIPYAVIEGQKKRRNTLHEFKKSAKTTLIKEDPLLK
IKTKKMNTPDQCANRCIRNKGLPFTCKAFVFDKTRKRCLWLPFNSMSSGVKKEFGHEFDL
YENKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCR
NPRGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQ
TPHRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCGIADFTMNDT
DVPMETTECIQGQGEGYRGTINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRN
PDGAESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRFGLTCSMWE
KNMEDLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPT
IVNLDHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWVLTARQCF
PARNKDLKEYEAWLGIHDVHGRDEKRKQVLNVSQLVYGPEGSDLVLLKLARPAVLDNFVS
TIDLPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQHHQGKVTLNES
EICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKW
IHKIILTYKVTQS
Download sequence
Identical sequences ENSSTOP00000022105 ENSSTOP00000002769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]