SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022146 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022146
Domain Number 1 Region: 30-514
Classification Level Classification E-value
Superfamily ALDH-like 6.28e-171
Family ALDH-like 0.00000000000249
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022146   Gene: ENSSTOG00000022883   Transcript: ENSSTOT00000022772
Sequence length 518
Comment pep:known_by_projection scaffold:spetri2:JH393291.1:19630051:19649442:1 gene:ENSSTOG00000022883 transcript:ENSSTOT00000022772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLRALLAALPTLLRAPRPACVAAMSTGTFTVSQPLNYRGGARVEPVDASGTETAFEPAT
GRIIATFTCSGEKEVDLAVQNAKAAFKLWSKKSGLERCRILLEAAKIIRERTEDIATVET
INNGKSVFEARLDVASCWQCLEYFAGLAGSLAGEHVQLPGGSFGYTRREPLGVCVGIGAW
NYPFQIACWKSAPALACGNAMVFKPSPFTPVSALLLAEIYAEAGVPPGLFNVVQGGAATG
QFLCQHPDVAKVSFTGSVPTGVKIMELSAKGIKPVTLELGGKSPLIIFSDCDLENAVRGA
MMANFLTQGQVCCNGTRVFVQRAILDKFTEEVVEQTQKIKIGDPLLEDTRMGPLINRPHL
ERVLGFVKSAKQQGARVLCGGDPYVPQDPKLKDGYYMRPCVLTDCRDDMTCVREEIFGPV
MSILPFDTEAEVLERANDTTFGLAAGVFTRDIQRAHRVAAELQAGSCFINNYNVSPVELP
FGGYKKSGFGRENGRVTIEYYSQLKTVYVEMGDVETAF
Download sequence
Identical sequences I3NCP9
ENSSTOP00000022146 XP_005319913.1.77405 ENSSTOP00000022146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]