SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022388 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022388
Domain Number 1 Region: 127-255
Classification Level Classification E-value
Superfamily DNA clamp 1.66e-47
Family DNA polymerase processivity factor 0.000000356
Further Details:      
 
Domain Number 2 Region: 1-126
Classification Level Classification E-value
Superfamily DNA clamp 3.43e-42
Family DNA polymerase processivity factor 0.000000577
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022388   Gene: ENSSTOG00000026676   Transcript: ENSSTOT00000023506
Sequence length 261
Comment pep:novel scaffold:spetri2:JH393295.1:13766256:13771432:1 gene:ENSSTOG00000026676 transcript:ENSSTOT00000023506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFEARLVQGSILKKVLEALKDLINEACWDISSGGVNLQSMDSSHVSLVQLTLRSEGFDTY
RCDRNLAMGVNLTSMSKILKCAGNEDIITLRAEDNADTLALVFEAPNQEKVSDYEMKLMD
LDVEQLGIPEQEYSCVVKMPSGEFARICRDLSHIGDAVVISCAKDGVKFSASGELGNGNI
KLSQTSNVDKEEEAVTIEMNEPVQLTFALRYLNFFTKATPLSPTVTLSMSADVPLVVEYK
IADMGHLKYYLAPKIEDEEGS
Download sequence
Identical sequences A0A091CSB3 A0A1S3EQ86 G1SKZ3 G5B4W1 I3NDE1
XP_004840837.1.39548 XP_005320555.1.77405 XP_005380885.1.28644 XP_010605829.1.5607 XP_010605830.1.5607 XP_012866536.1.60039 XP_015338155.1.40921 XP_017197251.1.1745 ENSOCUP00000003512 ENSSTOP00000022388 HGL_H00000368438-2 ENSSTOP00000022388 9986.ENSOCUP00000003512 ENSOCUP00000003512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]