SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022460 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022460
Domain Number 1 Region: 958-1171
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.03e-102
Family Thrombospondin C-terminal domain 0.00000000559
Further Details:      
 
Domain Number 2 Region: 26-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-38
Family Laminin G-like module 0.0000148
Further Details:      
 
Domain Number 3 Region: 835-957
Classification Level Classification E-value
Superfamily TSP type-3 repeat 2.75e-35
Family TSP type-3 repeat 0.000000602
Further Details:      
 
Domain Number 4 Region: 766-837
Classification Level Classification E-value
Superfamily TSP type-3 repeat 7.72e-17
Family TSP type-3 repeat 0.00022
Further Details:      
 
Domain Number 5 Region: 494-545
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 3.92e-16
Family TSP-1 type 1 repeat 0.0001
Further Details:      
 
Domain Number 6 Region: 437-492
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000106
Family TSP-1 type 1 repeat 0.0000891
Further Details:      
 
Domain Number 7 Region: 693-778
Classification Level Classification E-value
Superfamily TSP type-3 repeat 0.0000000000000549
Family TSP type-3 repeat 0.00012
Further Details:      
 
Domain Number 8 Region: 319-377
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000157
Family VWC domain 0.0053
Further Details:      
 
Domain Number 9 Region: 383-431
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000288
Family TSP-1 type 1 repeat 0.00099
Further Details:      
 
Domain Number 10 Region: 550-603
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022460   Gene: ENSSTOG00000028868   Transcript: ENSSTOT00000021952
Sequence length 1171
Comment pep:known_by_projection scaffold:spetri2:JH393299.1:17877139:17904679:-1 gene:ENSSTOG00000028868 transcript:ENSSTOT00000021952 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLWGMALLALWAWPSALAGDPDEEDTSFDLFSVSNINRKTIGAKQFRGPDPGVPAYRFVR
FDYIPPVNSEDLSRILRTMRRKEGFFLTAQLKQDRKSRGTLLALEGPGASQRQFEIVSNG
PADTLDLTYWTEGTPHPVSLEDVGLADSQWKNITVQVAGETYSLYVGCDLIDSFSLDEPF
YEQLSAERSRMYVAKGATRESHFRGLLQNMHLVFENSVEDLLSRKGCPGAQGAEINAISE
HTETLHLGPHVTTEFVGQGVAKRPEVCEHSCEELGHMINELSGLHVLVNQLSENLRRVSN
DNQFLLELLGGPPKTRNITACWQDGRFFAENETWVVDSCTSCTCKKFKVVCHQISCPPAT
CASPAFAEDECCPSCSHSMDSEEGWSPWAEWTECSVTCGSGTQQRGRSCDVTSNTCLGPS
IQTRACSLGKCDTRIRQNGGWSHWSPWSSCSVTCGVGNITRIRLCNSPVPQMGGKNCKGS
GRETKACQRDPCPIDGRWSPWSPWSACTVTCAGGIRERSRVCNSPEPQYGGKDCVGDVKE
HQMCNKRSCPLDGCLSNPCFPGAQCNSFPDGSWSCGSCPVGFLGNGTHCEDLDECAVVAD
ICFSTNKVSRCVNSEPGFHCLPCPPRYKGNQPFGVGLEAARTEKQVCEPENPCKDKTHNC
HRHADCIYLGHFSDPMFKCECQTGYAGDGLICGEDSDLDGWPNSNLLCATNATYHCVKDN
CPQLPNSGQEDFDKDGVGDACDEDDDNDGVSDEKDNCPLLFNPRQSDYDKDEVGDRCDNC
PYVHNSAQIDTDSNGEGDACSVDIDGDDVFNERDNCPYVYNTDQRDTDGDGVGDHCDNCP
LMHNPDQTDVDNDLVGDECDNNEDIDDDGHQNNQDNCPYISNANQADHDSDGQGDACDSD
DDNDGVPDDRDNCRLVFNPQQEDSDGDGRGDICKDDFDNDKVPDIDDVCPENYAISETDF
RNFQMVPLDPKGTTQIDPNWVIRHQGKELVQTANSDPGIAVGFDEFGSVDFSGTFYVNTD
RDDDYAGFVFGYQSSSRFYVVMWKQVTQTYWEDQPSRAYGYSGVSLKVVNSTTGTGEHLR
NALWHTGNTEGQVRTLWHDPKNIGWKDYTAYRWHLTHRPRTGYMRVLVHEGKQVMADSGP
IYDQTYAGGRLGLFVFSQEMVYFSDLKYECR
Download sequence
Identical sequences ENSSTOP00000022460 ENSSTOP00000022460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]