SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022625 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022625
Domain Number 1 Region: 5-204
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 4.24e-51
Family D-ribulose-5-phosphate 3-epimerase 0.00000714
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022625   Gene: ENSSTOG00000020078   Transcript: ENSSTOT00000027903
Sequence length 212
Comment pep:novel scaffold:spetri2:JH393312.1:696665:697329:-1 gene:ENSSTOG00000020078 transcript:ENSSTOT00000027903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALGCKIGLSILNSHLVNLGTECLRMLISGADYLHLDIMDEHFVPSITFGHPVVESLCQD
PFFDMHMMMSKPEQWVKPIYTFHLKATENPGALIKDIQENGMKVGLAIKPGTTVEYLAPW
DMALVMTMEPGIGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGPDTVHKCAKAGANMIV
SGSAIMRSEDSRSVINLVRNVCSEAAQKCSLD
Download sequence
Identical sequences ENSSTOP00000022625 ENSSTOP00000022625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]