SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022630 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022630
Domain Number 1 Region: 13-375
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 1.91e-73
Family Extradiol dioxygenases 0.0000000172
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022630   Gene: ENSSTOG00000021683   Transcript: ENSSTOT00000028314
Sequence length 391
Comment pep:novel scaffold:spetri2:JH393368.1:2543054:2552566:1 gene:ENSSTOG00000021683 transcript:ENSSTOT00000028314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TTYTDKGAKPEKGRFLHFHSVTFWVGNAKQAASFYCSKMGFEPLAYRGLETGFREVVSHV
VKQGKKADSAAVRTAQVHPQNKPGLGVALACSKQGLAKDSGAPAFTVSPCSISLQKARER
GAKVVREPWVEEDKFGKVKFAVLQTYGDTTHTLVEKKNYTGRFLPGFEAPLLKDSLLPKL
PKCGLEIIDHIVGNQPDQEMLSASEWYLRNLQFHRFWSVDDTQVHTEYSSLRSIVVTNYE
ETIKMPINEPAMGRKKSSIQEYVDYNGGAGVQHIALKTQDIITAIRNLQERGMEFLTVPS
TYYKLLRENLKTAKIRVKESIDVLEELQILMDYDEKGYLLQIFTKPMQDRPTLFLEVIKR
HNHQGFGAGNFNSLFKALEDAQAIRGNLTDL
Download sequence
Identical sequences ENSSTOP00000022630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]