SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022730 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022730
Domain Number 1 Region: 307-574
Classification Level Classification E-value
Superfamily Kelch motif 1.83e-65
Family Kelch motif 0.0000565
Further Details:      
 
Domain Number 2 Region: 22-142
Classification Level Classification E-value
Superfamily POZ domain 1.88e-34
Family BTB/POZ domain 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022730   Gene: ENSSTOG00000029074   Transcript: ENSSTOT00000023806
Sequence length 589
Comment pep:known_by_projection scaffold:spetri2:JH393359.1:2012217:2013999:1 gene:ENSSTOG00000029074 transcript:ENSSTOT00000023806 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSVHENRKSRASSGSINIYLFHKSSYADSVLTHLNLLRQQRLFTDVLLHAGNRTFPCH
RAVLAACSRYFEAMFSGGLKESQDSEVNFDNSIHPEVLELLLDYAYSSRVIINEENAESL
LEAGDMLEFQDIRDACAEFLEKNLHPTNCLGMLLLSDAHQCTKLYELSWRMCLSNFQTIR
KNEDFLQLPQDMVVQLLSSEELETEDERLVYESAINWISYDLKKRYCYLPELLQTVRLAL
LPAIYLMENVAMEELITKQRKSKEIVEEAIRCKLKILQNDGVVTSLCARPRKTGHALFLL
GGQTFMCDKLYLVDQKAKQIIPKADIPSPRKEFSACAIGCKVYITGGRGSENGVSKDVWV
YDTLHEEWSKAAPMLVARFGHGSAELKHCLYVVGGHTAATGCLPASPSVSLKQVEHYDPT
TNKWTMVAPLREGVSNAAVVSAKLKLFAFGGTSVSHDKLPKVQCYDQCENRWTVPATCPQ
PWRYTAAAVLGNQIFIMGGDTEFSACSAYKFNSETYQWTKVGDVTAKRMSCHAVASGNKL
YVVGGYFGIQRCKTLDCYDPTLDVWNSITTVPYSLIPTAFVSTWKHLPS
Download sequence
Identical sequences I3NED3
ENSSTOP00000022730 ENSSTOP00000022730 XP_005329010.1.77405 XP_015353281.1.40921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]