SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000022985 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000022985
Domain Number 1 Region: 6-128
Classification Level Classification E-value
Superfamily DNA clamp 2.58e-19
Family DNA polymerase processivity factor 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000022985   Gene: ENSSTOG00000021365   Transcript: ENSSTOT00000024438
Sequence length 382
Comment pep:known_by_projection scaffold:spetri2:JH393409.1:2345591:2353921:-1 gene:ENSSTOG00000021365 transcript:ENSSTOT00000024438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNDRSSRLVVQLHCKYGVRK
THNLSFQDCESLQAVFDPSLCPHVLRAPARILGEAILPFPPTLAEVTLGIGRGRRVILRS
YLEEEADSTVKAMVTEMSIGEEDFQQLQAPEGVAITFCLKEFRGLLSFAESAHLPLSIHF
DAPGRPAIFTIEDSLLDGHFVLATLSEPNLHSQDLGSPEPASDTPIFAYSTSHLDDFASD
DIDSYMIAMETTAGSEGPRALPSISLSPGPASEEEDEAEPSTVPGTPPPKKFRSLFFGSI
LAPVHSPQGPNPVLAEDSDGEG
Download sequence
Identical sequences ENSSTOP00000022985 ENSSTOP00000022985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]