SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023019 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023019
Domain Number 1 Region: 56-108,143-207
Classification Level Classification E-value
Superfamily POZ domain 0.00000385
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023019   Gene: ENSSTOG00000015270   Transcript: ENSSTOT00000025582
Sequence length 508
Comment pep:known_by_projection scaffold:spetri2:JH393296.1:11112175:11155580:1 gene:ENSSTOG00000015270 transcript:ENSSTOT00000025582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLITQQHKARLERRIVGSTNRWRLPQEPFFGDLLALPQMCQALGIDIEETLKNPERLRIP
KIQKIFTENLKDKASQNGEADVTLECLGFKWELHQPQLFQSETLTKLYLAALGRGGSSPR
RAKCQRIVKGHGRKGKVQERNRVKRMIISLKINDPAVTRAAFATALKNLYLKDEEMNVEE
VLGVLASAHVLQFSRLFKRCVVTMMNGLKPSTIKNFYLAGHRYKEEQLTTACEKWLEMNL
VPLMATQIHLRHIPQELLQKVLRSPRLFTFSEFHLLKTLLMWAYLQLNSKIQAIPIHETM
LTFFNSFPKKCCFLDRDIGQSWLPLFLCLRLHSITSGRDLEELRHINFFPESWLIRVTAN
HYHALESGGDMAHLKDLTTQAVRFGLLFDQENTTHSKMISIYGFFFEIKGIKHDTTSYSF
YMQRIRHTDLDSPSTICEHSAVSLKSERLVKYEIRAQALVEGRWQEFSTNQITQKFGFVQ
PCCRSHALKIQTVGIPIYASFAFIFPLS
Download sequence
Identical sequences ENSSTOP00000023019 ENSSTOP00000023019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]