SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023113 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023113
Domain Number 1 Region: 132-226
Classification Level Classification E-value
Superfamily VPS28 C-terminal domain-like 1.44e-35
Family VPS28 C-terminal domain-like 0.00033
Further Details:      
 
Domain Number 2 Region: 29-125
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 1.41e-33
Family VPS28 N-terminal domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023113   Gene: ENSSTOG00000010008   Transcript: ENSSTOT00000028396
Sequence length 228
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:7830114:7833060:1 gene:ENSSTOG00000010008 transcript:ENSSTOT00000028396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFHGIPATPGMGAPSYSVAAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALE
KAYIKDCVTPNEYTAACSRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERVKED
RPITIKDDKGNLNRCIADVVSLFITVMDKLRLEIRAMDEIQPDLRELMETMHRMSHLPPD
FEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLESAYNAFNRFLHA
Download sequence
Identical sequences ENSSTOP00000023113 ENSSTOP00000008981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]