SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023220 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023220
Domain Number 1 Region: 5-358
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 4.41e-49
Family Extradiol dioxygenases 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023220   Gene: ENSSTOG00000025497   Transcript: ENSSTOT00000023517
Sequence length 371
Comment pep:known_by_projection scaffold:spetri2:JH393284.1:26481883:26482995:1 gene:ENSSTOG00000025497 transcript:ENSSTOT00000023517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVHARRLCHIAFQVAAGQPLARDLQCLFGFQPLAAREAGGWRQLALRSGDAVFLVNEGA
GPGEPLYGLDPHHAVPSATNLCFDVDDASTAAQVLASRGCRVPVPPVNVRDAQGAATYAV
VSSPAGNLSLTLLERAGYHGPFLPGFGPVPSKPDAGWVSHVDHLTLACTPGSSPTLRRWF
QDCLGFHHLPLNPGEDPERGLEVVTESGNGGLRLMALQTPPGSIVPTLVLAESLPGATYR
QDQVEQFLVRHRGPGLQHVGLYTPNIMEASEGMALAGGRLLTPPEAYYQQPGKEKQILAA
GLIPGVLARQGILLDGDKGKFLLQVFTKSLFAEDTFFLELIQRQGATGFGQDNIRALWQS
IQEEAARSQKA
Download sequence
Identical sequences I3NFS3
ENSSTOP00000023220 ENSSTOP00000023220 XP_005318022.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]