SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023249 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023249
Domain Number 1 Region: 566-812
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.96e-85
Family Eukaryotic proteases 0.0000000175
Further Details:      
 
Domain Number 2 Region: 368-460
Classification Level Classification E-value
Superfamily Kringle-like 1.06e-38
Family Kringle modules 0.0000122
Further Details:      
 
Domain Number 3 Region: 90-183
Classification Level Classification E-value
Superfamily Kringle-like 2.42e-37
Family Kringle modules 0.0000354
Further Details:      
 
Domain Number 4 Region: 273-361
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-36
Family Kringle modules 0.0000191
Further Details:      
 
Domain Number 5 Region: 472-570
Classification Level Classification E-value
Superfamily Kringle-like 1.09e-34
Family Kringle modules 0.00000872
Further Details:      
 
Domain Number 6 Region: 183-266
Classification Level Classification E-value
Superfamily Kringle-like 2.66e-34
Family Kringle modules 0.00000846
Further Details:      
 
Domain Number 7 Region: 19-100
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 2.16e-21
Family Hairpin loop containing domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023249   Gene: ENSSTOG00000020315   Transcript: ENSSTOT00000023095
Sequence length 813
Comment pep:novel scaffold:spetri2:JH393299.1:11775243:11808482:-1 gene:ENSSTOG00000020315 transcript:ENSSTOT00000023095 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDCKEIVLLLLLFLKSGQGSSLDGYVNTQGASLFGVPKKHLGAQSIEECAARCEEETEFI
CRSFQYHSKEQQCVIMAENSKSSPVIRMRDVVLFEKKIYLSECKTGNGKTYRGTVSKTKS
GTVCQRWSANYPHKPNFFPEKFPREGLEENYCRNPDNDEKGPWCYTMDPEKRFEYCNIPE
CEEECMHCSGEHYEGKISKTMSGIECQAWDSQTPHAHGYIPSKFPNKNLKMNYCRNPDGE
PRPWCFTTDPNKRWELCNIPRCTTPPPSSGPTYQCLKGRGEDYRGKVAVTASGHTCQRWS
EQTPHQHNRTPENFPCKGLDENYCRNPDGETTPWCYTTNSDVRWEYCTIPSCGNSPTSTD
PLDVPALAPPEQTPVVQDCYQGNGQSYRGTSSTTITGKKCQSWSSMTPHAHEKTPEKFPN
AGLTMNYCRNPDADKSPWCYTTDPSVRWEYCNLKRCSETPGGAEESATAVQVPNVQTTSE
SDCMFGNGKSYRGTKATTVTGTPCQEWAAQEPHRHSIFTPQTNPRAGLEKNYCRNPDNDV
NGPWCYTTNPRKLFDYCDVPQCASLSSFDCGKPKVEPKKCSGRVVGGCVANAHSWPWQIS
LRTRFGRHFCGGSLISPEWVLTAAHCLEKSSRPSSYKVILGAHREVNLEPHVQDIEVAKL
FLEPTRADIALLKLSRPATITDKVIPICLPSPNYVVADRTECYITGWGETQGTSGAGFLK
EAHLPVIENKVCNRYEYLNGRVKPTELCAGHLDGGTDSCQGDSGGPLVCFEKDKYILQGV
TSWGLGCARPNKPGVYVRVSRFVNWIEGIMRNN
Download sequence
Identical sequences XP_005321483.1.77405 ENSSTOP00000023249 ENSSTOP00000023249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]