SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023337 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023337
Domain Number 1 Region: 314-415,544-660
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 4.56e-53
Family Phosphate binding protein-like 0.0000000108
Further Details:      
 
Domain Number 2 Region: 5-254
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.26e-19
Family L-arabinose binding protein-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023337   Gene: ENSSTOG00000020701   Transcript: ENSSTOT00000029555
Sequence length 1328
Comment pep:known_by_projection scaffold:spetri2:JH393340.1:8287544:8426817:-1 gene:ENSSTOG00000020701 transcript:ENSSTOT00000029555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGYRDFISFIKTTVDNSFVG
WDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLILSEARSLGLTGYDFFWIV
PSLVSGNTELIPKEFPSGLISVSYDDWDYSLEARVRDGLGILTTAASSMLDKFSYIPEAK
ANCYGQTEKPETPTHTLHQFMVNVTWDGKDLSFTEQGYQVHPRLVVIVLNKDREWEKVGK
WENQSLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVEDIDPLTETCVRNTVPCR
KFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLVTNGKHGKKVNNVWNGMI
GEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRSNGTVSPSAFLGAFLEAQ
WFLEQDILLTISQIYTFTGDLFSSIRYRVSLLSFAAPHGPSFTIGKAIWLLWGLVFNNSV
PVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVDQVTGLSDKKFQRPHDYS
PPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSLKTGKLDAFIYDAAVLNY
KAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALLQFVGDGEMEELETLWLT
GICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHLFYWKLRFCFTGVCSDRP
GLLFSISRGIYSCIHGVHIEEKKKSPDFSLTGSQSNMLKLLRSAKNTSNMSNMNSRLDSP
KRAPDFVQRGSLIMDMVSDKGNLIYSDNRSFQGKDSIFGDNMSELQTFVANRHKDNLNNY
VFQGQHPLTLNESNPNTVEVAVSTESKGNSRPRQLWKKSMESLRQDSLSQNPVSHRDEGT
TAENRTHSLKSPRYLPEEVAHSDISEASSRATGHRELDNKSHKTKDNFKRSLASKFPQDC
GEVERTYLKTQAGSPRDKIYTIDGEKEPSFHLDPPQFVENLALPENVGFPDTYQDPHENF
HKADSTLPLNRNPLRSEDGFPNNDHQYKLYAKHFTLKDKGSPLSEGSDRYRQGSTHCRSC
LSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNPAPRGEEAYQQDWTQNSA
LQSQKSRLRISRQRSYDNILDKPREMDPGRPPRSISLKDRERLLEGHLYGSLFSVPSSRL
SGNKSSLFPQGLEGSKRSQSLLPDHTSDNPFLHSHADDQRLVIGRCPSDPYKHSLPSQAA
NDSYLRSSLRSTASYCSRDSRGHSDVYISEHVLPYAANKNNMYSTPRVLNSCSNRRVYKK
MPSIESDV
Download sequence
Identical sequences ENSSTOP00000023337 ENSSTOP00000023337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]