SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023526 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023526
Domain Number 1 Region: 124-242
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 1.09e-17
Family 4'-Phosphopantetheinyl transferase SFP 0.0082
Further Details:      
 
Domain Number 2 Region: 50-116
Classification Level Classification E-value
Superfamily 4'-phosphopantetheinyl transferase 3.79e-16
Family 4'-Phosphopantetheinyl transferase SFP 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023526   Gene: ENSSTOG00000023451   Transcript: ENSSTOT00000025964
Sequence length 292
Comment pep:novel scaffold:spetri2:JH393286.1:13077741:13078644:1 gene:ENSSTOG00000023451 transcript:ENSSTOT00000025964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVFPANRFCLVPSMEGMHWAFSCGTWLPGHAEWLLACDPSSTREGTHWPVVFARDDKAAT
AGRLIIRKLVTEKLNIPWNHIHLQRTAKGKPVLAKDTLNSYPNFNFNISHQGDYAVFAAE
PELQVGIDIMKTSFPGQGSIPKLFHIMKRKFTNKQWETIRISFKDEGTQLDMFYRNWALK
ETFIKAIGVGLGFELQWFKFDISPLNFLPLLDGEEEKEWAFEESKIDEHDFVSVALRKPN
GSRHEDVSSHEFTILTFNDLISYAIPMTPEDPSFWDCFSFTEEIPIRNSTKS
Download sequence
Identical sequences ENSSTOP00000023526 ENSSTOP00000023526

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]