SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023621 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023621
Domain Number 1 Region: 10-122
Classification Level Classification E-value
Superfamily POZ domain 1.26e-18
Family BTB/POZ domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023621   Gene: ENSSTOG00000023495   Transcript: ENSSTOT00000019521
Sequence length 712
Comment pep:known_by_projection scaffold:spetri2:JH393391.1:4810709:4815015:1 gene:ENSSTOG00000023495 transcript:ENSSTOT00000019521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSSASSKILYRNPRFLRLAFLQLHQQQQSGVFCDVLLQAEGEAVPAHCCILSACSPFFT
ERLERERPAQGRKVVLELGGLKIRTLRKLVDFLYTSEMEVSREEAQDVLSAARQLRVSEL
ESLQLEGGKLVKTPQGRRLNRECLQPPSAAPISARVVAPTRRPRTPLPVTQTPCPLGAVR
LKSLGKEEGPQEKGNRPNAENLSGTLLLKRKARACLTPQEKSSSPSSHSQGLKENKDDSV
LGPTAVSPPSLYPTVDERLLPRKIRLSRSKPSPDVCTSKPSILSGSSTVPTAPGRRLWRQ
RSINKEAPEDKQKPGRASPLQNTPSPSGLGKAGGSKKQSPEVRAPNSDSAEEGQIGRVKL
RKIVNGTCWEVVQEPPLKNSQDSPQIPDPGRVLEPPGAQLSSINEQEMPSTRLELCQDSP
VSRLQDFLLSASHSPGHSVVKSEFGSSPELVGKEPMMNIDCREPYAFDTALLRQPCEAEE
YRITSAAATSELEEILDFMLCGSDIEPPVGSLESPEVEGCRTPSYHLTETGKNWIEGEEW
CLPDMELWPRELTGLEKEPASENKEPIEPFSPLVMPSEVNEGGVLSVGDSWTPHLEITNS
QPLDGQGDKLLHIDSPDPLQRSYRDLSPPCSNWAETELDVSLTMDEELYPAPEASKEAFG
NSELLGPLPDSSEDEEIDVVDWTAEGRLGPASVPSVWPDPSSESETEVDILT
Download sequence
Identical sequences ENSSTOP00000023621 ENSSTOP00000023621

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]