SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023755 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023755
Domain Number 1 Region: 28-104
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000596
Family Growth factor receptor domain 0.0025
Further Details:      
 
Domain Number 2 Region: 98-164
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000067
Family VWC domain 0.023
Further Details:      
 
Domain Number 3 Region: 191-237
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000116
Family TSP-1 type 1 repeat 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023755   Gene: ENSSTOG00000025361   Transcript: ENSSTOT00000020824
Sequence length 250
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:7997743:8010315:-1 gene:ENSSTOG00000025361 transcript:ENSSTOT00000020824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTAQTQLLAFSLLCLLSKVCAQLCPTPCACPWPPPRCPLGVPFVLDGCGCCRVCARRL
GEPCDHLHVCDSSQGLVCQPGTGPGGRGAVCLLGEDDAGCELDGRLYQDGETFQPHCRLL
CRCEDGGLTCLPLCSEDVRLPSRDCPRPRRVEVPGKCCPEWVCDQAAGRAVQPPQGQGPQ
FSGLMAPAPPGIPCPEWSTAWGPCSTTCGLGVATRVSNQNAFCQLETQRRLCLPRPCLPA
GSRRPGHTAF
Download sequence
Identical sequences I3NHA8
ENSSTOP00000023755 ENSSTOP00000023755 XP_005325352.1.77405

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]