SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000023824 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000023824
Domain Number 1 Region: 50-187
Classification Level Classification E-value
Superfamily Thioesterase/thiol ester dehydrase-isomerase 1.02e-28
Family 4HBT-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000023824   Gene: ENSSTOG00000022145   Transcript: ENSSTOT00000019380
Sequence length 208
Comment pep:known_by_projection scaffold:spetri2:JH393280.1:9138821:9140914:-1 gene:ENSSTOG00000022145 transcript:ENSSTOT00000019380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGLLVASLALALSFFALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQRYAGRVLPSDLD
LLLHMNNARYLREADVARAAHLTRCGVLGALRELGAHAVLAASCARYRRSLRLFEPFEVR
TRLLGWDDRAFYLEARFVSLRDGFLCALLRSRQHVLGTSPERVVQHLCKRRVEPPELPED
LQHWITYNEASSQLLRAESGLSDVIKDQ
Download sequence
Identical sequences I3NHH7
XP_005316173.1.77405 ENSSTOP00000023824 ENSSTOP00000023824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]