SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000005273 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000005273
Domain Number 1 Region: 300-357
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 1.28e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000596
Further Details:      
 
Domain Number 2 Region: 11-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000016
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000005273   Gene: ENSSTOG00000005900   Transcript: ENSSTOT00000005894
Sequence length 357
Comment pep:known_by_projection scaffold:spetri2:JH393298.1:9599905:9631294:-1 gene:ENSSTOG00000005900 transcript:ENSSTOT00000005894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLIASSFNLKQEPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDG
FHSEEQQLLLQVQQQHQPQQQQHHHHHHHQQTQPQQTVPQQAQTQQVLIPASQQATAPQV
IVPDSKLIQHMNASNMSAAATAATLALPAGVTPVQQILTNSGQLLQVVRAANGAQYIFQP
QQSVVLQQQVIPQMQPGGVQAPVIQQVLAPLPGGITPQTGVIIQPQQILFTGNKTQVIPT
TVAAPTPAQAQITAAGQQQPQAQAAQQQAPLVLHDEEEDKEKDGAEDGQVEEEPLNSEDD
VSDEEGQELFDTENVVVCQYDKIHRSKNKWKFHLKDGIMNLNGRDYIFSKAIGDAEW
Download sequence
Identical sequences ENSSTOP00000005273 ENSSTOP00000005273

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]