SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000006474 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000006474
Domain Number 1 Region: 2-567
Classification Level Classification E-value
Superfamily Acetyl-CoA synthetase-like 3.01e-81
Family Acetyl-CoA synthetase-like 0.0000272
Further Details:      
 
Domain Number 2 Region: 754-1096
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.37e-46
Family Quinoprotein alcohol dehydrogenase-like 0.01
Further Details:      
 
Domain Number 3 Region: 553-608
Classification Level Classification E-value
Superfamily ACP-like 0.0000366
Family Acyl-carrier protein (ACP) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000006474   Gene: ENSSTOG00000007226   Transcript: ENSSTOT00000007246
Sequence length 1098
Comment pep:known_by_projection scaffold:spetri2:JH393292.1:18557760:18588409:-1 gene:ENSSTOG00000007226 transcript:ENSSTOT00000007246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLQELVQQAASLYLDKIAVCFDECNNQPPVYYTYKTVINAASELSDFLLLHCDFEGIRE
IGLYCQPGINLPSWILGILQVPAAYAPIDPDSPPSLSTHFMKKCNLKYILVEKKQINKFT
SLYETLLNYDTVTVEHKDLVLFRLHWENADMNLKLNDRKEKCAKEKRKNSMRSENNSIEE
KEHMDVRLKHCLAYVLHTSGTTGTPKIVRVPHACILPNIQHFQVLFDITQDDVLFLASPL
TFDPSVVEMFVALSSGASLLIIPPSVKVLSSKLAEVLFSHHRVTVLQATPTLLRRFGSQL
IKSTILSSSTSLRVLALGGEAFPSLTVLKSWRGEGNKTQIFNIYGVTEVSSWATTYRIPE
KILNSTLKCDMPVQLGFPLLGTVVEVRDTNGFTIQEGSGQVFLGGKNRVCFVDDEITVPL
GTMRATGDFVTVKDGEMFFLGRKDSQIKRHGKRLNIELLQRVAEELQQVESCAVTWYNQE
KLILFIVSKDDLVKNYIFKELQKYLPNHAIPDEIVLIDTLPFTSHGKIDVSELNKIYLDY
MNSKPEKKLNGKEELWEKLQFLWKSVLSLSEDLLKVPDESLFLNSGGDSLKSIRLLNEIE
ELVGTSVPGLLEIILSSSILEIYNHILQIVFPDEDETFSKNYATKRKLSDTNQEEASGKS
LYKSSLLPLSYNSEINAFIALSRGSQILSLNTSRFLTMLGHYPSACSSDFTIQTNIENLK
SLSPPAIFGKSEDPSYVAKVCEEGKPVIGAEKMELHIRWRSDSGKCVDASPLVIIPAVDK
SSATVYIGSHSHRMKAVDLYSGKVRWEQTLGDRIESSACVSKCGNFIMVGCYNGLVYVLK
SINGEKYWMFTTEDAVKSSATMDPTTGLFYIGSHDKHVYALDIYEKKCVWKLACGGTVFS
SPCLNPIPHHLYCATLGGLLLAINPATGNIVWKHSCGKPLFSSPRCCQQYICIGCVDGNL
LCFTHLGEQVWQFSTSGPIFSSPCTAASEQEIFFGSHDFFIYCCNMEGHLQWKFETTSRV
YATPFVFHNHNCSNEMLLAAASTDGKLWILESQSGKLQSVYELPGEVFSSPVVWESMLII
GCRNNYIYCLDLLSGSQK
Download sequence
Identical sequences I3M9C8
XP_005320081.1.77405 ENSSTOP00000006474 ENSSTOP00000006474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]