SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000008687 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000008687
Domain Number 1 Region: 299-553
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 9.37e-79
Family Eukaryotic proteases 0.00000000337
Further Details:      
 
Domain Number 2 Region: 105-211
Classification Level Classification E-value
Superfamily Kringle-like 9.18e-33
Family Kringle modules 0.00014
Further Details:      
 
Domain Number 3 Region: 214-302
Classification Level Classification E-value
Superfamily Kringle-like 2.9e-31
Family Kringle modules 0.0000195
Further Details:      
 
Domain Number 4 Region: 36-85
Classification Level Classification E-value
Superfamily FnI-like domain 3.56e-20
Family Fibronectin type I module 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000008687   Gene: ENSSTOG00000009680   Transcript: ENSSTOT00000009683
Sequence length 560
Comment pep:known_by_projection scaffold:spetri2:JH393595.1:490142:502647:1 gene:ENSSTOG00000009680 transcript:ENSSTOT00000009683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTMKKGLLCVLLLCEVVFTLPRQEIYTRFRRGARSYRVMCRDEKTQMIYQQHESWLRPM
LRSNRVEYCWCNSGRPQCHSVPIKSCSESRCFNGGTCWQAIYFSDFVCQCPEGFAGKRCE
IDTSATCYKDQGITYRGTWSTVESGAECVNWNSSVLALKSYNGRRPDAIKLGLGNHNYCR
NPDRDSKPWCYVFKAGKYTSEFCSTPACSKGKNEDCYFGKGLAYRGTQSLTTSGASCLPW
NSMILIGKSYTAWKTNSQALGLGKHNYCRNPDGDAKPWCHVLKDRKLTWEYCDMPQCSTC
GLRQYKQPQFRIKGGLFTDITSHPWQAAIFAKNRRSPGERFLCGGVLISSCWVLSAAHCF
LERFPPHHLKVVLGRTYRVVPGEEEQKFEVEKYIVHNEFDDDTYDNDIALLQLKSDSLQC
AQDSNSVRTVCLPDANLQLADWTECELSGYGKHEASSPFYSERLKEAHVRLYPSSRCTSQ
HMFNKTVTNNMLCAGDTRSGGNQANLHDACQGDSGGPLVCVKDKRMTLVGIISWGLGCGK
KDVPGIYTKICNHDQENSAP
Download sequence
Identical sequences ENSSTOP00000008687 ENSSTOP00000008687

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]