SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000009023 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000009023
Domain Number 1 Region: 208-353,405-555,623-646
Classification Level Classification E-value
Superfamily TROVE domain-like 2.09e-62
Family TROVE domain-like 0.0051
Further Details:      
 
Domain Number 2 Region: 2030-2327
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.49e-53
Family WD40-repeat 0.00035
Further Details:      
 
Domain Number 3 Region: 1653-1936
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.5e-50
Family WD40-repeat 0.0022
Further Details:      
 
Domain Number 4 Region: 1127-1356
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000174
Family Nitrogenase iron protein-like 0.051
Further Details:      
 
Domain Number 5 Region: 2259-2338,2445-2598
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000942
Family Quinoprotein alcohol dehydrogenase-like 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000009023   Gene: ENSSTOG00000010031   Transcript: ENSSTOT00000010060
Sequence length 2602
Comment pep:known_by_projection scaffold:spetri2:JH393687.1:575434:609076:-1 gene:ENSSTOG00000010031 transcript:ENSSTOT00000010060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKLRGHVSAHPDVLSLENRCLAMLPVLQPLEKTHESMSAHSDILSLKSQCLVRILDLKT
MEKPHRHVSAHPDILSLENRCLATLPSVKSTVSASPLFQCLQIPHMMQTDLCSLNTSNRL
VSEPPSWSTQGLSEGLDLLTCPKVLKSISATERVQKGTLQKEFKEEKKPEEKEGAEAPMP
LYCLSLGEEEEELALKLTSEDSESHLEPTDQVLQEKKMALMSLLCSTLASNVNVKDAYDP
TQVSILEVCTELAPLEPVFILKAALYTRQQLNIRDLANKVVAIAAFLPVCRPHLRRYFCA
IVHLPSDWIQVAEFYQSLAEGDQTKLVPLPACLRAAMTDKFAQFDEYQLAKYNPRKHRAK
RRPNRPPRPPRTEPLFSEQKRYFAKSLWPLEREQLEFEATYNAVPEKKNQPRFTLKKLVQ
RLHIHEPAHHVQALLGYRYPSNLQLFSRSGLPGPWDSSRAGKRMKLSRPETWERELSLRG
NKASVWEELIDNGKLPFMAMLRNLCNLLRVGISARHHGLILQRLQHEKSVINSRQFPFRF
LNAHDSIDNLEAQLRNRALPFPSNINLMRRIMIRKSKKVRRPARWKHLCKLSRRELRAAM
KIPAIYEELQREKLKIHKARQGNYDLEILDQYRQALEAAVNLSVKHSLPPLPGRTLLVYL
TDADADKLCPKSNIQGPSLNYVLLLIGMMMARAEHVDLLLCGRGTVKTIVLKAEEGILKT
AIKLQAHVQELEEKDEWPLHTFGKYLLSLAVQRVSVDRVILFGQRMDEEMLNAAKQLFWE
HVNSKCLFVGVCLRKTQYILPSLNPNDVTLAGCTDGILKFIAEHGASRLLEHVGQMDKIF
KIPPPPGKSQVLTLRPLEEDTLRPLAPISQHRWRSIRLFISSTFRDMHGERDLLLRSVLP
ALQARAAPHRISLHGIDLRWGITEEESHRNRQLEVCLGEVENSQLFVGILGSRYGYIPPN
YNLPDHPHFSWVQQYPSGRSVTEMEVMQFLNRNQRLQPSAQALIYFRDSSFLSSVPDAWR
PDFISESKEAAHRISELKNYLSRQKEITCRRYSCEWGGVAAGRPYVGGLEEFGQLVLQDV
WNMIQKLYLQPGAQMEQPVPIPDDDLVQTTFQQQRNPPSPARLRLLQDTVRQLMQPHGRL
SLVTGQSGQGKTTFLASLVSAMQAPDGAKVAPLVFFHFSGARPDQGLALNLLRRLCTYLH
RKLQESSALPSTYRGLVWELHQRLLPKAAQCLQPDQSLVMIIDGADRLVDQNGHQISDWI
PKSLPRWVHLVLSMSSDSGLGETLEQSQGAHVVALGPLEPSARAQLVREELVLYGKRLEE
SPFNNQMRLLLVKRGSGLPLYLRLVTDHLRLFTVYEQVSERLRTLPATLPLLLQFILSTL
EQEHGHDVLPQALATLEVTRNGLTMDQLHAVLSAWQILPSRTQSWEEAVDAVNNGDPYPM
GPFAYLIQSLRSLLGEGPLERPGARLCLPDGPLRTAAKHRYGKRPGLENTAHILIAAQLW
KTCGPDALSTFQSCPPEALGDLPYHLLHSGNRGLLAEFLTSLHVVAAHLELGLIPRLLEA
HALYASSVSEEEQMVPEANVAVFRTFLQQQAPILSQYPLLLYQQAANQPLDSPLCCQAPL
LSQRWHLQRTLHWLNKPQTMGDQQNSSLSLAVSSSPTAVAFSPSEQRAAVGTANGTVYLL
DLRTWQEEKSVVSGCDGISSCAFLSESALFLTAFDGLLELWDLQHGCRDRVLQTKAHQYQ
ITGCCLSPDRRLLATVCLGGCLKLWDTVRGQLAFQHTCPKSLNCIAFHPEGQVVATGSWG
GSVSFFRVDGLQVIKELGAPGASVRTLAFNVPGRVVAVGRLDRTVELWAWQDGARLAAFS
AHCGFVAAVLFLNARCQLLTAGEDGKVQVWSGSLGQPRGCLGSLPVSPALSVALSPDGDR
VAVGYRADGIRIYKISPGSQGAQCQVLDVAVSALAWLSSRVLVSGAEDGSLQGWVLKEHS
LQSLWLLSRSQKPVLGLATSQELLAAASEDFTVRLWSRQLLMQPLKAEDFLCDTELLGHQ
GPVNCCSFSSDGGRLATGGRDRNLLCWDVRMPQTPLLIRSFPACHRDWVTGCSWTKDNLL
LSCSTDGSVGLWDPDSGQQLGQFRGHQSAVSAVVAVEEHVVSVGRDGALKVWDHQGVELT
SIPAHSGPISHCAAALEPCPAGQPGSELLVVTVGLDGATRLWHPLLVCQKHTLLGHSGPV
SAAAVSETSGLLLTSSEDGSVRLWQVPKETDETYRPKSSAAITAVAWAPDGSVAVSGNQV
GELTLWQEAKSVATAQAPGRVSALIWYSAHTFFVLSADEKISEWQVELQKDSTSRNFSYS
LHLKQVLQDVGVLIGLGLAPDGCSLILAKADLELLHMKPGDAPSVIGKKYAQHPVILSTH
KEYGVFFLQPGDPGFLSFWKQKESGEFEESPDFDLNLDNPSRTQITITQAKPESESSFLC
ASSDGMLWNLAACTPEGEWTTGHLWQKKVKMPKTQTPETDSSMCCELDTNMESWQTTTHL
KTRQRRKIHSGSVTALHVLPELLVTASKDRDVKLWERPSMKLLGLFRCEGAVSCLEPWLG
PNSTLHLAVGDTQGNVYFLCWE
Download sequence
Identical sequences ENSSTOP00000009023 ENSSTOP00000009023

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]