SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000013236 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000013236
Domain Number 1 Region: 137-230
Classification Level Classification E-value
Superfamily TAFH domain-like 3.53e-36
Family TAFH domain-like 0.00000269
Further Details:      
 
Domain Number 2 Region: 423-470
Classification Level Classification E-value
Superfamily Histone-fold 2.18e-17
Family TBP-associated factors, TAFs 0.00019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000013236   Gene: ENSSTOG00000014768   Transcript: ENSSTOT00000014774
Sequence length 638
Comment pep:known_by_projection scaffold:spetri2:JH393324.1:9695293:9722107:-1 gene:ENSSTOG00000014768 transcript:ENSSTOT00000014774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPGMVLVRSENGQLLMIPQQALAQMQAQAHAQAQPQSTMAPRPAAPTSAPPVQISTVQA
PGTPIIARQVTPTTIIKQVSQAQTTVQPTATLQRSPGVQPQLVLGGSAQAASLGTATAVQ
AGAPQRTVPGTASASTAATETMENVKKCKNFLSTLIKLASSGKQSTETAANVKELVQNLL
DGKIEAEDFTSRLYRELNSSPQPYLVPFLKRSLPALRQLTPDSAAFIQQSQQQQPPASQA
TTALTAVVLSGSVQRTAGKTAASVSSALQPPVISLTQPTQVGPGKQAQSAPLVIQQPPKP
GALIRPPQVTLTQTPMVALRQPHNRIMLTTPQQIQLNQLQPVPVVKPTVLPGTKALPAVA
TQAAAAQKNKLKEPGGGSFRDDDDINDVASMAGVNLSEESARILATNSELVGTLTRSCKD
DTFLLPAPLQRRILEIGKKHGITELHPDVVSYVSHATQQRLQNLVEKISETAQQKNFSYK
DDDRYEQASDVRAQLKFFEQLDQIEKQRKDEQEREILMRAAKAMSRSRQEDPEQLRLKQK
AKEMQQQELAQMRQRDANLTALAAIGPRKKRKVDCAGPGSGAEGSGPGVAVPGSSGVGAP
RQFTRQRITRVNLRDLIFCLENERETSHSLLLYKALLK
Download sequence
Identical sequences ENSSTOP00000013236 ENSSTOP00000013236

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]