SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000017329 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSTOP00000017329
Domain Number - Region: 434-487
Classification Level Classification E-value
Superfamily RILP dimerisation region 0.0432
Family RILP dimerisation region 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000017329   Gene: ENSSTOG00000013627   Transcript: ENSSTOT00000023114
Sequence length 596
Comment pep:known_by_projection scaffold:spetri2:JH393309.1:7755650:7807316:1 gene:ENSSTOG00000013627 transcript:ENSSTOT00000023114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHNNRLIKFFEKVGCQVKPTHGEGVGVIGVIECNFLKPAYNKQDFEYTKEYRLTINALA
QKLNAYWKEKISQENFEISATFRKIPDQTWVQCDECLKWRKLPGKVDPCTLPARWFCYYN
SHPKYRRCSVPEEQELIDEDLYLSKTKKQLNQSVEKKKISMENENLQAFSNPPKIPSVQD
MAGLNDKTIEYERIDSPTLLPSVGEESRSPSLQLKPLDSSVFQFSSKYKWILGEEPVEKR
RRLQNEMPTSPLDYSMPGSYRRVEAAVAYAEGENSHDKSSSERSTPPCLFPEYPEANKNT
GQNRETSVLYPGAQDQRQGSLLPEELEDQMPRLVAEESNRGESNREEVNKGPFVAVVGVA
KGVRDSGAPIQLIPFNREELAERRKTVESWNPVPYSSVASAAAIGEKGRGYEESGGRNTP
KMKNQRELEELKRTTEKLERVLAERNLFQQKVEELEQERNHWHSEFKKVQHELVTYSTQE
TEGLYWSKKHMGYRQAEFQILKAELERTKEEKQELQEKLKETETHLEVLRKAQVSYRTPE
GDDLERALAKLTRLRIHVSYLLTSVLPHLELREIGYDSEQVDGILYTVLEANHILD
Download sequence
Identical sequences ENSSTOP00000017329

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]