SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSSTOP00000021330 from Ictidomys tridecemlineatus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSTOP00000021330
Domain Number 1 Region: 780-911,973-1039
Classification Level Classification E-value
Superfamily Hemopexin-like domain 6.67e-39
Family Hemopexin-like domain 0.0009
Further Details:      
 
Domain Number 2 Region: 69-108
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000484
Family Somatomedin B domain 0.0012
Further Details:      
 
Domain Number 3 Region: 27-67
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000102
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSTOP00000021330   Gene: ENSSTOG00000023458   Transcript: ENSSTOT00000019450
Sequence length 1039
Comment pep:known_by_projection scaffold:spetri2:JH393291.1:4111736:4128726:-1 gene:ENSSTOG00000023458 transcript:ENSSTOT00000019450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEWKILPICLLLLLSVFLIQQVSSQDVPSCAGRCGEGYSRDAICNCDYNCQHYMECCPDF
KKVCTVELSCKGRCFESFSRGRECDCDSQCKKFGKCCSDYETFCEEVHNPTTPPPSKTAP
PPPGASQTIKSTSKRSPKSPKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSTIRKIK
SSKNSAANKELQKKPKVKDDKKKPPKKEPKKEPPVVDEAGSGLDSGDPKLTPTPDTPTTQ
SNKVTTSPKTTTIKPESPKPSPPPNSDTSKKTSSTANKETTVETKETTVTNQQTSTSEKQ
KTTSAKEIRSAEKTSAKDLAPTPEVPAETTTKDPSLTTPKEPAPTTTKEPAPTTTKEPAS
TTTKEPVPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPAPTTPKEPASTSPKEPAPTTPK
EPVPTTTKKPAPTTPKEPAPTTPKEPAPTTTKNPAPTTPKESTTTKEPAPTPPEEPVLTT
PKEPAPTTPKKPAPTTPKKPAPIPPEEPAPTTPKESAPTTPKEPAPTPPEEPAPTNPKEP
APTTPKKPAPTTPKTPAPATTMELPTTPKTPAEATPEFSAGPTPKAPDNSAKEPTVPTTK
TPEVTTAAVPKDSSFKTTTLKTPPTEESRNEPEESPGPEDTAIDSKATTPKPQKPTKAPK
KPTSTKKPPKAPKKPTSTKKPSSPKGKTPKTTPTPPKTTIPPTSPKSVLQTTSSPKQTPD
SETVEVNPNNEDAEGDGGEKPHMIPRPPVLTPIVIPGTDHIVRGPSQGISSHSLLLDDTN
LCNGRPVDGLTALRNGTLVAFRGHYFWMLNPFTPPPPPRRITEVWGIPSPIDTVFTRCNC
EGKTFFFKDSQYWRFTNDVQDAGYPKQIVKGFGGLTGKIVAALSVAKYKDRPESVYFFKR
GGNVQQYVYKQEPVRKCTGRRPVINYSVYGDAAQVRRRRFERAIGPQTHTIRIHYTPVRV
SYQDKGTLHNEVKMSTMWRGLPNVVTSAITLPNIRRPDGYDYYAFSKDQYYNVNVPSRTA
RAVTTRDGKTLSKVWYKCP
Download sequence
Identical sequences ENSSTOP00000021330 ENSSTOP00000021330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]