SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386009863|ref|YP_005928140.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386009863|ref|YP_005928140.1|
Domain Number 1 Region: 25-201
Classification Level Classification E-value
Superfamily ClpP/crotonase 5.36e-29
Family Clp protease, ClpP subunit 0.018
Further Details:      
 
Domain Number 2 Region: 374-440
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000392
Family NfeD domain-like 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|386009863|ref|YP_005928140.1|
Sequence length 448
Comment hypothetical protein PPUBIRD1_0229 [Pseudomonas putida BIRD-1]
Sequence
MIARCWRLLLLLLLLGITPGGQAAPGAVWVLNIDDAIGPASADYLVRSLSQAQAQGAQLV
VIRMDTPGGLDSAMRQMIKAILASPVPVASYVAPSGARAASAGTYILYASHVAAMAPGTN
LGAATPVRIGGAPGTPSDDKAKGGDDETLARKQVNDAAAYIRGLAQMRGRNADWAEQAVR
EAVSLSASEALRLNVIDQVADDLSDLLRKLDGKTLQVAGQPRQLQTAGASVVEHLPDWRT
RVLAVITNPSVALILIMIGVYGLLFEFMNPGSAVGGVVGGICLLLALYALQLLPVSFAGV
ALILLGITFMIAEAFLPSFGVVGFGGIVAFVVGALILIDTDAPGFGIPLALIGTLALLSA
LLIGGVLGMALKARQRALVSGDAGLVGSLVTVTQVMASDPFCGVVLAQGEPWQARCATPL
QTGQNVRVTARHGVMLEVSAAAPATQGE
Download sequence
Identical sequences A0A0A7PTV7
WP_014589308.1.31851 WP_014589308.1.34900 WP_014589308.1.42045 WP_014589308.1.47320 WP_014589308.1.48025 WP_014589308.1.62773 gi|386009863|ref|YP_005928140.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]