SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386013159|ref|YP_005931436.1| from Pseudomonas putida BIRD-1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386013159|ref|YP_005931436.1|
Domain Number 1 Region: 5-179
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 9.42e-29
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386013159|ref|YP_005931436.1|
Sequence length 181
Comment Cytochrome B561 [Pseudomonas putida BIRD-1]
Sequence
MVSSNPAPHYARLSIALHWLMLVLLAAVYALIELRGLFPKDSVERNLMKDLHFMLGLSVF
VLVWLRLAMRLSRPTPPIVPKPPAWQTGLAHLMHLALYLMMIGLPLAGWLILSAADKPVP
FFGLELPHLIGPNPDQAKFIKGWHERIGSWGYWLIGLHALAGLYHHYVQRDNTLLRMLPY
K
Download sequence
Identical sequences A0A0A7PYM4
WP_014591878.1.31851 WP_014591878.1.34900 WP_014591878.1.42045 WP_014591878.1.47320 WP_014591878.1.48025 WP_014591878.1.62773 gi|386013159|ref|YP_005931436.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]